KDM5D

KDM5D
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KDM5D, HY, HYA, JARID1D, SMCY, lysine demethylase 5D
Зовнішні ІД OMIM: 426000 MGI: 99780 HomoloGene: 55838 GeneCards: KDM5D
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001146705
NM_001146706
NM_004653
NM_011419
RefSeq (білок)
NP_001140177
NP_001140178
NP_004644
NP_035549
Локус (UCSC) Хр. Y: 19.7 – 19.74 Mb Хр. Y: 0.9 – 0.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KDM5D (англ. Lysine demethylase 5D) – білок, який кодується однойменним геном, розташованим у людей на Y-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 1 539 амінокислот, а молекулярна маса — 174 073[4].

Послідовність амінокислот
1020304050
MEPGCDEFLPPPECPVFEPSWAEFQDPLGYIAKIRPIAEKSGICKIRPPA
DWQPPFAVEVDNFRFTPRVQRLNELEAQTRVKLNYLDQIAKFWEIQGSSL
KIPNVERKILDLYSLSKIVIEEGGYEAICKDRRWARVAQRLHYPPGKNIG
SLLRSHYERIIYPYEMFQSGANHVQCNTHPFDNEVKDKEYKPHSIPLRQS
VQPSKFSSYSRRAKRLQPDPEPTEEDIEKHPELKKLQIYGPGPKMMGLGL
MAKDKDKTVHKKVTCPPTVTVKDEQSGGGNVSSTLLKQHLSLEPCTKTTM
QLRKNHSSAQFIDSYICQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPE
IPRGIWRCPKCILAECKQPPEAFGFEQATQEYSLQSFGEMADSFKSDYFN
MPVHMVPTELVEKEFWRLVSSIEEDVTVEYGADIHSKEFGSGFPVSNSKQ
NLSPEEKEYATSGWNLNVMPVLDQSVLCHINADISGMKVPWLYVGMVFSA
FCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMKMLTPELFDSQ
PDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYN
FAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAAFPETLDL
NLAVAVHKEMFIMVQEERRLRKALLEKGVTEAEREAFELLPDDERQCIKC
KTTCFLSALACYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPTML
HKLKIRAESFDTWANKVRVALEVEDGRKRSFEELRALESEARERRFPNSE
LLQRLKNCLSEVEACIAQVLGLVSGQVARMDTPQLTLTELRVLLEQMGSL
PCAMHQIGDVKDVLEQVEAYQAEAREALATLPSSPGLLRSLLERGQQLGV
EVPEAHQLQQQVEQAQWLDEVKQALAPSAHRGSLVIMQGLLVMGAKIASS
PSVDKARAELQELLTIAERWEEKAHFCLEARQKHPPATLEAIIRETENIP
VHLPNIQALKEALTKAQAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPV
GLEELRQLELQVLTAHSWREKASKTFLKKNSCYTLLEVLCPCADAGSDST
KRSRWMEKALGLYQCDTELLGLSAQDLRDPGSVIVAFKEGEQKEKEGILQ
LRRTNSAKPSPLAPSLMASSPTSICVCGQVPAGVGVLQCDLCQDWFHGQC
VSVPHLLTSPKPSLTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLV
ALQRLPVRLPEGEALQCLTERAIGWQDRARKALASEDVTALLRQLAELRQ
QLQAKPRPEEASVYTSATACDPIREGSGNNISKVQGLLENGDSVTSPENM
APGKGSDLELLSSLLPQLTGPVLELPEAIRAPLEELMMEGDLLEVTLDEN
HSIWQLLQAGQPPDLDRIRTLLELEKFEHQGSRTRSRALERRRRRQKVDQ
GRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDH
SPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL

Кодований геном білок за функціями належить до оксидоредуктаз, регуляторів хроматину. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза. Локалізований у ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Agulnik A.I., Bishop C.E., Lerner J.L., Agulnik S.I., Solovyev V.V. (1997). Analysis of mutation rates in the SMCY/SMCX genes shows that mammalian evolution is male driven. Mamm. Genome. 8: 134—138. PMID 9060413 DOI:10.1007/s003359900372
  • Lee M.G., Norman J., Shilatifard A., Shiekhattar R. (2007). Physical and functional association of a trimethyl H3K4 demethylase and Ring6a/MBLR, a polycomb-like protein. Cell. 128: 877—887. PMID 17320162 DOI:10.1016/j.cell.2007.02.004
  • Akimoto C., Kitagawa H., Matsumoto T., Kato S. (2008). Spermatogenesis-specific association of SMCY and MSH5. Genes Cells. 13: 623—633. PMID 18459961 DOI:10.1111/j.1365-2443.2008.01193.x

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:11115 (англ.) . Процитовано 13 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q9BY66 (англ.) . Архів оригіналу за 12 жовтня 2016. Процитовано 13 вересня 2017.

Див. також

Read other articles:

King of Cyprus James IIKing of CyprusReign1460[1]/1464[2] – 10 July 1473PredecessorCharlotte and LouisSuccessorJames IIIContendersCharlotte and Louis (1460–1464)Bornc. 1438/1439 or c. 1440Died10 July 1473SpouseCatherine CornaroIssueJames III of CyprusHousePoitiers-LusignanFatherJohn II of CyprusMotherMarietta de Patras (concubine) James II (French: Jacques; c. 1438/1439 or c. 1440 – 10 July 1473) was the penultimate King of Cyprus (usurper), reigning from...

 

Запрос «1612» перенаправляется сюда; см. также другие значения. Годы 1608 · 1609 · 1610 · 1611 — 1612 — 1613 · 1614 · 1615 · 1616 Десятилетия 1590-е · 1600-е — 1610-е — 1620-е · 1630-е Века XVI век — XVII век — XVIII век 2-е тысячелетие XV век — XVI век — XVII век — XVIII век — XIX век 1590-е 1590 1591 1592 1...

 

Pour les articles homonymes, voir Blokhine. Oleg Blokhine Oleg Blokhine en 2013 Biographie Nom Oleg Vladimirovitch Blokhine Nationalité Ukrainien Naissance 5 novembre 1952 (71 ans) Kiev (RSS d'Ukraine) Taille 1,80 m (5′ 11″) Poste Ailier gauche Parcours junior Années Club 1962-1969 Dynamo Kiev Parcours senior1 AnnéesClub 0M.0(B.) 1969-1988 Dynamo Kiev 585 (269) 1988-1989 Vorwärts Steyr 045 0(10) 1989-1990 Aris Limassol 028 00(7) 1969-1990 Total 658 (286) Sélections en ...

Fernmeldeturm Großhau Datei:Grosshaufmt1p.jpg Basisdaten Ort: Großhau (Hürtgenwald) Land: Nordrhein-Westfalen Staat: Deutschland Höhenlage: 382 m ü. NHN 50.7371676.403472Koordinaten: 50° 44′ 13,8″ N, 6° 24′ 12,5″ O Verwendung: Fernmeldeturm, Rundfunksender Zugänglichkeit: Sendeturm öffentlich nicht zugänglich Besitzer: Deutsche Funkturm Turmdaten Bauzeit: 1973 Bauherr: Deutsche Bundespost Baustoffe: Beton, Stahlbeton Betriebszeit:...

 

Princely state of India Narsinghgarh Stateनर्सिन्घ्गढ़ रियासतPrincely State1681–1948 Flag Coat of arms Narsinghgarh State in the Imperial Gazetteer of IndiaCapitalNarsinghgarhArea • 19481,920 km2 (740 sq mi)Population • 1948 140,000 HistoryHistory • Established 1681• Accession to the Union of India 1948 Succeeded by India Narsinghgarh fort, the official Residence of the rulers of the state until Ra...

 

José Riesgo José Riesgo en Lo quiero muerto (1968)Información personalNacimiento 8 de septiembre de 1919Madrid, EspañaFallecimiento 16 de mayo de 2002 (82 años)Nacionalidad EspañolaInformación profesionalOcupación actorAños activo desde 1943[editar datos en Wikidata] José Riesgo (n. Madrid; 8 de septiembre de 1919 - f. 16 de mayo de 2002[1]​) fue un actor español. Biografía Tras la Guerra Civil Española, se dedicó a la fontanería hasta que en 1943 empieza a trab...

قفز تزحلفيمعلومات عامةالمنتسبون متزلج قفز الخصائصالتصنيف التزلج الشمالي — رياضات أولمبية التجهيزات المستعملة زحلوفة القفز التزحلفي — ski jumping hill (en) تعديل - تعديل مصدري - تعديل ويكي بيانات منظر من أعلى مسار القفز التزلجي القفز التزلجي [1] أو الوثب التزحلفي[2] أو أو الت

 

Der Titel dieses Artikels ist mehrdeutig. Zur gleichnamigen kreisfreien Stadt siehe Shenzhou (Hengshui) Shenzhou-Raumschiff Shenzhou (chinesisch 神舟, Pinyin shénzhōu – „Götterboot“) ist ein für drei Personen ausgelegter, nicht wiederverwendbarer Raumschiff-Typ im Rahmen des Bemannten Raumfahrtprogramms der Volksrepublik China. Der erste unbemannte Testflug erfolgte am 19. November 1999, der erste bemannte Flug am 15. Oktober 2003. Inhaltsverzeichnis 1 Geschichte 1....

 

The Sydney Metropolitan Bus Service Contracts are contracts issued by the Government of New South Wales to metropolitan bus operators in Sydney, Australia, to operate its public bus route network. Since 2005, the government has moved from individual contracts with operators to larger contract regions, leading to the consolidation of bus operators. History State Transit Custom Coaches bodied Volvo B7RLE at Circular Quay in June 2014 in Transport for NSW livery Forest Coach Lines Custom Coaches...

2002 studio album by Nas God's SonStudio album by NasReleasedDecember 13, 2002 (2002-12-13)Recorded2001–2002GenreHip hopLength57:06LabelIll WillColumbiaProducerNasAgileThe AlchemistAlicia KeysChucky ThompsonEminemRon BrowzSalaam RemiNas chronology The Lost Tapes(2002) God's Son(2002) Street's Disciple(2004) Singles from God's Son Made You LookReleased: September 10, 2002 I CanReleased: February 11, 2003 Get DownReleased: July 8, 2003 God's Son is the sixth studio album by...

 

Australian model (born 1991) Jesinta FranklinFranklin at the InStyle Awards in May 2015BornJesinta Campbell (1991-08-12) 12 August 1991 (age 32)Gold Coast, AustraliaHeight1.75 m (5 ft 9 in)[1]Spouse Lance Franklin ​(m. 2016)​Children2Beauty pageant titleholderTitleMiss Universe Australia 2010Hair colorBlondeEye colorBlueMajorcompetition(s)Miss Universe Australia 2010(Winner)Miss Universe 2010 (2nd Runner-Up)(Miss Congeniality) Jesinta F...

 

Digital motion graphics and compositing software Adobe After EffectsAdobe After Effects 2020 running on macOS Big SurOriginal author(s)Company of Science and ArtDeveloper(s) CoSA (1993) Aldus Corporation (1993-1994) Adobe Inc. (1994-present) Initial releaseJanuary 1993; 30 years ago (1993-01)Stable release2023 (23.6)[1] / June 20, 2023; 5 months ago (2023-06-20) Written inC/C++[2]Operating system Windows 10 (x64 only) V20H2 or later mac...

Po Lam寶琳Stasiun angkutan cepat MTRNama TionghoaHanzi Tradisional 寶琳 Hanzi Sederhana 宝琳 Arti harfiahTreasure fine jadeTranskripsiTionghoa StandarHanyu PinyinBǎolínYue: KantonRomanisasi YaleBóulahmJyutpingBou2lam4 Informasi umumLokasiPo Lam, Tseung Kwan ODistrik Sai Kung, Hong KongKoordinat22°19′21″N 114°15′29″E / 22.3224°N 114.258°E / 22.3224; 114.258Koordinat: 22°19′21″N 114°15′29″E / 22.3224°N 114.258°E࿯...

 

19th-century human-powered vehicle; predecessor to the bicycle Wooden dandy horse (around 1820), a patent-infringing copy of the first two-wheeler Original Laufmaschine of 1817 made to measure. The dandy horse, a derogatory term for what was first called a Laufmaschine (in German), then a vélocipède or draisienne (in French and then English), and then a pedestrian curricle or hobby-horse,[1] or swiftwalker,[2] is a human-powered vehicle that, being the first means of transpo...

 

American author J.C. HallmanBorn1967 (age 55–56)Occupation Essayist Author NationalityAmericanAlma materIowa Writers' WorkshopJohns HopkinsGenre Non-fiction Fiction Notable works‘’B & Me’’WebsiteJCHallman.com J.C. Hallman (born 1967) is an American author, essayist, and researcher. His work has been widely published in Harper's, GQ, The Baffler, Tin House Magazine, The New Republic, and elsewhere. He is the author of six books, and his nonfiction combines memoir, h...

Pour les articles homonymes, voir essai (homonymie). Un joueur plongeant pour marquer un essai. Au rugby à XIII, un essai est l'action de jeu consistant à aplatir le ballon dans l'en-but adverse. Cette action permet de marquer quatre points en vue de l'attribution de la victoire dans un match, et de tenter une transformation, valant deux points supplémentaires. Techniquement, un essai est accordé lorsqu'un attaquant exerce une pression sur le ballon de haut en bas dans l'en-but adverse en...

 

American college basketball season 2018–19 Valparaiso Crusaders men's basketballConferenceMissouri Valley ConferenceRecord15–18 (7–11 MVC)Head coachMatt Lottich (3rd season)Assistant coaches Luke Gore Todd Townsend Rob Holloway Home arenaAthletics–Recreation CenterSeasons← 2017–182019–20 → 2018–19 Missouri Valley Conference men's basketball standings vte Conf Overall Team W   L   PCT W   L   PCT Loyola Chicago 12 – 6 ...

 

Luxembourgian footballer Ben Payal Personal informationFull name Ben PayalDate of birth (1988-09-08) 8 September 1988 (age 35)Place of birth Luxembourg (city), LuxembourgPosition(s) right wingerYouth career LorentzweilerSenior career*Years Team Apps (Gls)2005–2007 Jeunesse Esch 37 (0)2007–2013 F91 Dudelange 90 (0)2013–2016 Fola Esch 52 (0)2016–2022 UNA Strassen 105 (1)International career‡2006–2016 Luxembourg 73 (0) *Club domestic league appearances and goals, correct as of 2...

Formação de galáxias, aglomerados de galáxias e estruturas maiores a partir de pequenas flutuações iniciais de densidade Parte de uma série sobreCosmologia física Big Bang · Universo Idade do Universo Cronologia do Universo Universo primordial Inflação · Nucleossíntese Antecedentes Onda gravitacional (GWB) Micro-ondas (CMB) · Neutrinos (CNB) Expansão · Futuro Lei de Hubble · Desvio para o vermelho Expansão métrica do espaço Métrica de FLRW ·...

 

This article is about the mountain range called Pindus. For other uses of these names, see Pindus (disambiguation). Pindos redirects here. For other uses, see Pindos (disambiguation). This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Pindus – news · newspapers · books · scholar · JSTOR (March 2008) (Learn how ...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!