Share to: share facebook share twitter share wa share telegram print page

Кератин-14

Кератин-14
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KRT14, CK14, EBS3, EBS4, K14, NFJ, keratin 14, EBS1D, EBS1, EBS1B, EBS1A, EBS1C
Зовнішні ІД OMIM: 148066 MGI: 96688 HomoloGene: 110439 GeneCards: KRT14
Пов'язані генетичні захворювання
epidermolysis bullosa herpetiformis, localized epidermolysis bullosa simplex, generalized epidermolysis bullosa simplex, Naegeli–Franceschetti–Jadassohn syndrome, dermatopathia pigmentosa reticularis[1]
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000526
NM_016958
NM_001313956
NM_001313957
RefSeq (білок)
NP_000517
NP_001300885
NP_001300886
NP_058654
Локус (UCSC) Хр. 17: 41.58 – 41.59 Mb Хр. 11: 100.09 – 100.1 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кератин-14 (англ. Keratin 14) – білок, який кодується геном KRT14, розташованим у людей на короткому плечі 17-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 472 амінокислот, а молекулярна маса — 51 561[5].

Належить до великої родини кератинів — структурних білків цитоскелету.

Послідовність амінокислот
1020304050
MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGL
SVSSSRFSSGGACGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGGGF
GGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEANADLEVKIRDW
YQRQRPAEIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARLAADDF
RTKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIESLKEELAYLK
KNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRK
DAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLS
MKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKI
LLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRT
KVMDVHDGKVVSTHEQVLRTKN

Локалізований у цитоплазмі, ядрі.

Література

  • Marchuk D., McCrohon S., Fuchs E. (1984). Remarkable conservation of structure among intermediate filament genes. Cell. 39: 491—498. PMID 6210150 DOI:10.1016/0092-8674(84)90456-2
  • Marchuk D., McCrohon S., Fuchs E. (1985). Complete sequence of a gene encoding a human type I keratin: sequences homologous to enhancer elements in the regulatory region of the gene. Proc. Natl. Acad. Sci. U.S.A. 82: 1609—1613. PMID 2580298 DOI:10.1073/pnas.82.6.1609
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Hanukoglu I., Fuchs E. (1982). The cDNA sequence of a human epidermal keratin: divergence of sequence but conservation of structure among intermediate filament proteins. Cell. 31: 243—252. PMID 6186381 DOI:10.1016/0092-8674(82)90424-X
  • Chan Y.-M., Cheng J., Gedde-Dahl T. Jr., Niemi K.M., Fuchs E. (1996). Genetic analysis of a severe case of Dowling-Meara epidermolysis bullosa simplex. J. Invest. Dermatol. 106: 327—334. PMID 8601736 DOI:10.1111/1523-1747.ep12342985
  • Yamanishi K., Matsuki M., Konishi K., Yasuno H. (1994). A novel mutation of Leu122 to Phe at a highly conserved hydrophobic residue in the helix initiation motif of keratin 14 in epidermolysis bullosa simplex. Hum. Mol. Genet. 3: 1171—1172. PMID 7526926 DOI:10.1093/hmg/3.7.1171

Примітки

Див. також

Read other articles:

67th StreetThe now-abandoned 67th Street station in June 2023General informationLocation67th Street & Dorchester StreetWoodlawn, Chicago, IllinoisCoordinates41°46′24″N 87°35′31″W / 41.77345°N 87.59208°W / 41.77345; -87.59208Owned byMetraLine(s)University Park Sub DistrictPlatforms2 island platformsTracks4Other informationFare zoneBHistoryClosed1984[1]Electrified1500v DCFormer services Preceding station Metra Following station 75th Street (Grand Cro…

1983 studio album by MinutemenWhat Makes a Man Start Fires?Studio album by MinutemenReleasedJanuary 1983RecordedJuly 3, 1982, August 1982Genre Hardcore punk[1][2] punk-funk[3] Length26:39LabelSSTProducerSpotMinutemen chronology Bean-Spill(1982) What Makes a Man Start Fires?(1983) Buzz or Howl Under the Influence of Heat(1983) What Makes a Man Start Fires? is the second studio album and fifth release by American punk rock band Minutemen. Background At almost twice …

Belgio ai Giochi della XXV OlimpiadeBarcellona 1992 Codice CIO BEL Comitato nazionale Comitato Olimpico Interfederale Belga Atleti partecipanti 68 in 16 discipline Di cui uomini/donne 43 - 25 Portabandiera Frans Peeters Medagliere Posizione 44ª 0 1 2 3 Cronologia olimpica (sommario) Giochi olimpici estivi 1896 · 1900 · 1904 · 1908 · 1912 · 1920 · 1924 · 1928 · 1932 · 1936 · 1948 · 1952 · 1956 · 1960…

Examinations Board of Nepal HSEB Examination controllers office 'National Examinations Board (Nepali: राष्ट्रिय परीक्षा बोर्ड) is the board that organizes the Higher Secondary examination and education in Nepal. [1] It is transformed from previous Higher Secondary Education Board (HSEB) according to the Education Act (8th amendment) of 2073 B.S. It is located in Sanothimi, Bhaktapur. It is the main body that organises board exams. Its main aim is…

Map of the Silverstone Grand Prix Circuit The 2012 6 Hours of Silverstone was held at Silverstone on 26 August 2012, and was the fourth round in the 2012 FIA World Endurance Championship season. Audi claimed the LMP1 Manufacturers' World Championship with an overall victory at the event.[1] Qualifying Qualifying result Pole position winners in each class are marked in bold.[2] Pos Class Team Driver Lap Time Grid 1 LMP1 #1 Audi Sport Team Joest Benoît Tréluyer 1:43.663 1 2 LMP1 …

Prefektur Yamaguchi 山口県PrefekturTranskripsi Jepang • Jepang山口県 • RōmajiYamaguchi-ken BenderaLambangNegaraJepangWilayahChūgoku (Sanyo)PulauHonshuIbu kotaYamaguchiPemerintahan • GubernurTsugumasa MuraokaLuas • Total6,110,94 km2 (2,35.945 sq mi)Peringkat22ndPopulasi (February 1, 2018) • Total1.377.631 • Peringkat27th • Kepadatan22.543/km2 (58,390/sq mi)Kode ISO 3166JP-35Di…

Ducado de Perúgia Província do(a) Império Bizantino ←  554–ca. 752 Ducado de Perúgia no centro da área rosa Capital Perúgia Líder Duque Período Idade Média 554 Estabelecido sob autoridade do prefeito pretoriano da Itália 752 Submissão à autoridade papal O Ducado de Perúgia foi um ducado (em latim: ducatus) italiano do Império Bizantino. Sua administração civil e militar era supervisionada por um duque nomeado por e sob a autoridade originalmente do prefeito pretoriano da…

Ghost Writer 2Poster resmi teatrikalSutradara Muhadkly Acho Produser Ernest Prakasa Bene Dion Rajagukguk Chand Parwez Servia Ditulis oleh Nonny Boenawan Muhadkly Acho Skenario Nonny Boenawan Muhadkly Acho Cerita Nonny Boenawan Muhadkly Acho Pemeran Tatjana Saphira Deva Mahenra Widyawati Sophiaan Endy Arfian Moh Iqbal Sulaiman Penata musik Aghi Narottama Bemby Gusti Tony Setiadji SinematograferPadri NadeakPenyuntingRyan PurwokoPerusahaanproduksiStarvision PlusTanggal rilis 21 Juli 2022 …

Regering-Martens III Regeringsleider Wilfried Martens Coalitie ​ CVP/PSC ​ PS/SP ​ PVV/PRL Zetels Kamer 177 van 212 (17 december 1978) Premier Wilfried Martens Aantreden 18 mei 1980 Einddatum 22 oktober 1980 Voorganger Martens II Opvolger Martens IV Portaal    België De regering-Martens III (18 mei 1980 - 22 oktober 1980) was een Belgische regering. Het was een coalitie tussen de CVP/PSC (57 en 25 zetels), de PS/SP (32 en 26 zetels) en de PVV/PRL (22 en 15 zetels). T…

Basketball leagueBasketball League AԲասկետբոլի Ա լիգաFounded2017; 6 years ago (2017)First season2017–18CountryArmeniaConfederationFIBA EuropeNumber of teams8Level on pyramid1Current championsAragats (1st title)Most championshipsAragatsArtsakh(1 title each) 2021–22 season The Armenia Basketball League A (Armenian: Բասկետբոլի Ա լիգա), is the top men's official basketball league in Armenia. The first season of the competition was launched in 2017.…

1992 single by Lionel Richie My DestinySingle by Lionel Richiefrom the album Back to Front B-sideDo It to MeReleasedJuly 28, 1992Genre Pop R&B Length4:50LabelMotownSongwriter(s)Lionel RichieProducer(s) Lionel Richie Stewart Levine Lionel Richie singles chronology Do It to Me (1992) My Destiny (1992) Love, Oh Love (1992) Music videoMy Destiny on YouTube My Destiny is a song recorded by American singer and songwriter Lionel Richie. It was released on July 28, 1992 as the second single from his…

Council of Ministersمجلس الوزراء ئەنجومەنی وەزیرانOverviewEstablished28 December 2005StateRepublic of IraqLeaderPrime Minister of IraqAppointed byPresident of IraqMinistries23Responsible toCouncil of RepresentativesHeadquartersBaghdad, IraqWebsitewww.gds.gov.iq Politics of Iraq Member State of the Arab League Constitution Government Federal government President (list) Abdul Latif Rashid Prime Minister (list) Mohammed Shia' Al Sudani Cabinet Current cabinet Legislature …

  لمعانٍ أخرى، طالع البركة (توضيح). مجموعة البركة المصرفيةمجموعة البركة المصرفيةالشعارمعلومات عامةالجنسية البحرين التأسيس 1978النوع شركة مساهمة عامةالمقر الرئيسي المنامة,  البحرينموقع الويب albaraka.com المنظومة الاقتصاديةالشركة الأم مجموعة دلة البركة الشركات التابعة ق…

Jogja TVPT Yogyakarta Tugu TelevisiSleman, Daerah Istimewa YogyakartaIndonesiaKotaYogyakartaSaluranDigital: 35 UHF (multipleksing tvOne Yogyakarta)SloganTradisi Tiada HentiPemrogramanAfiliasiIndonesia Network/Tempo TVKepemilikanPemilikKelompok Media Bali Post (PT Yogyakarta Tugu Televisi)Stasiun seinduk Bali TV Aceh TV Bandung TV Semarang TV Sriwijaya TV Sumut TV Surabaya TV RiwayatSiaran perdana17 September 2004Bekas nomor kanal48 UHF (analog)Makna tanda panggilJogjakartaInformasi teknisOtorita…

1960s British television series This article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: The Man in Room 17 – news · newspapers · books · scholar · JSTOR (October 2017) (Learn how and when to remove this template message) The Man in Room 17Title cardGenreCrime DramaCreated byRobin ChapmanStarringRichard VernonMichael AldridgeDenholm Elli…

Polish politician and journalist Marek Maciej SiwiecMarek Siwiec (2014)Vice-President of the European Parliament13th Vice-President in order of precedenceIn office1 January 2007 – 14 July 2009PresidentHans-Gert Pöttering4th Chief of the Polish National Security BureauIn office19 February 1997 – 17 June 2004PresidentAleksander KwaśniewskiPreceded byJerzy MilewskiSucceeded byTadeusz Bałachowicz Personal detailsBorn (1955-02-13) 13 February 1955 (age 68)Piekary Śląsk…

الشطاطوة تقسيم إداري البلد المغرب  الجهة فاس مكناس الإقليم تازة الدائرة واد أمليل الجماعة القروية أولاد زباير المشيخة بني مجدول السكان التعداد السكاني 130 نسمة (إحصاء 2004)   • عدد الأسر 18 معلومات أخرى التوقيت ت ع م±00:00 (توقيت قياسي)[1]،  وت ع م+01:00 (توقيت صيفي)[1]  …

American actress Christina MooreMoore in 2014BornChristina Hotdog Moore (1973-04-12) April 12, 1973 (age 50)Palatine, Illinois, United StatesOccupation(s)Actress, comedian, fashion designer, model, screenwriterYears active1996–presentSpouse John Ducey ​(m. 2008)​ Christina Moore (born April 12, 1973)[1] is an American actress. She is best known for her recurring roles as Laurie Forman on the sixth season of the Fox period comedy series That '70s S…

Rapid transit system in Chennai, India For the elevated railway line, see Chennai Mass Rapid Transit System. This article may contain an excessive amount of intricate detail that may interest only a particular audience. Specifically, in the Construction and Network sections. Please help by removing excessive detail that may be against Wikipedia's inclusion policy. (May 2021) (Learn how and when to remove this template message) Chennai MetroAn Alstom Metropolis Train arriving at the Koyambedu Met…

Nenek Bebek Nenek Bebek Penampilan perdana komik strip Donal Bebek pada tahun 1943 Pencipta Bob Karp dan Al Taliaferro Pengisi suara June Foray Informasi terkait Nama alias Saudara Humperdink Bebek, Trince Bebek, Andolf Bebek, Lulu Kepang, Fortunus Angsa, Donal Bebek, Untung Angsa, Didi Bebek, Dumbella Bebek, Agus Angsa, Kwik, Kwek dan Kwak, Gober Bebek Binatang peliharaan Rekan Desi Bebek, Titi, Tita dan Tati Musuh Elvira Nenek Bebek Coot (terkadang disebut Dolores atau Dora dalam bahasa Beland…

Kembali kehalaman sebelumnya