Бета-актин

Бета-актин
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ACTB, BRWS1, PS1TP5BP1, Beta-actin, actin, beta, actin beta
Зовнішні ІД OMIM: 102630 MGI: 87904 HomoloGene: 110648 GeneCards: ACTB
Пов'язані генетичні захворювання
developmental malformations-deafness-dystonia syndrome, Baraitser-Winter syndrome[1]
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001101
NM_007393
RefSeq (білок)
NP_001092
NP_031419
Локус (UCSC) Хр. 7: 5.53 – 5.56 Mb Хр. 5: 142.89 – 142.89 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Бета-актин (англ. Actin beta) – білок, який кодується геном ACTB, розташованим у людей на короткому плечі 7-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 375 амінокислот, а молекулярна маса — 41 737[5].

Послідовність амінокислот
1020304050
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK
DSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE
HPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG
IVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSF
TTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITI
GNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLS
TFQQMWISKQEYDESGPSIVHRKCF

Білок має сайт для зв'язування з АТФ, нуклеотидами. Локалізований у цитоплазмі, цитоскелеті.

Література

  • Ponte P., Ng S.Y., Engel J., Gunning P., Kedes L. (1984). Evolutionary conservation in the untranslated regions of actin mRNAs: DNA sequence of a human beta-actin cDNA. Nucleic Acids Res. 12: 1687—1696. PMID 6322116 DOI:10.1093/nar/12.3.1687
  • Nakajima-Iijima S., Hamada H., Reddy P., Kakunaga T. (1985). Molecular structure of the human cytoplasmic beta-actin gene: interspecies homology of sequences in the introns. Proc. Natl. Acad. Sci. U.S.A. 82: 6133—6137. PMID 2994062 DOI:10.1073/pnas.82.18.6133
  • Ohmori H., Toyama S., Toyama S. (1992). Direct proof that the primary site of action of cytochalasin on cell motility processes is actin. J. Cell Biol. 116: 933—941. PMID 1734024 DOI:10.1083/jcb.116.4.933
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Hanukoglu I., Tanese N., Fuchs E. (1983). Complementary DNA sequence of a human cytoplasmic actin. Interspecies divergence of 3' non-coding regions. J. Mol. Biol. 163: 673—678. PMID 6842590 DOI:10.1016/0022-2836(83)90117-1
  • Stueven T., Hartmann E., Goerlich D. (2003). Exportin 6: a novel nuclear export receptor that is specific for profilin.actin complexes. EMBO J. 22: 5928—5940. PMID 14592989 DOI:10.1093/emboj/cdg565

Примітки

Див. також

Read other articles:

Second largest city of Kosovo Municipality and city in KosovoPrizrenMunicipality and cityView of Prizren FlagSealPrizrenShow map of KosovoPrizrenShow map of EuropeCoordinates: 42°12′46″N 20°44′21″E / 42.21278°N 20.73917°E / 42.21278; 20.73917CountryKosovoDistrictPrizrenGovernment • TypeMayor–council • MayorShaqir Totaj (PDK) • CouncilPrizren Municipal CouncilArea • Municipality626.86 km2 (242.03 sq...

 

Mongolei Kapitän Ganzorig Chimiddorj Aktuelles ITF-Ranking 120 Statistik Erste Teilnahme 2008 Davis-Cup-Teilnahmen 2 davon in Weltgruppe 0 Bestes Ergebnis 6. Platz in Asien/OzeanienZone Gruppe IV (2014) Ewige Bilanz 3:7 Erfolgreichste Spieler Meiste Siege gesamt Badrachyn Mönchbajar (5) Meiste Einzelsiege Erdenebajaryn Düürenbajar (3) Meiste Doppelsiege Oyunbatyn Baatar, Badrachyn Mönchbajar (je 2) Bestes Doppel Oyunbatyn Baatar / Badrachyn Mönchbajar (2) Meiste Teilnahmen Baasandschawyn

 

ميل في الساعةمعلومات عامةالنوع وحدة سرعة[1] لديه أجزاء ميل — ساعة تستخدم لقياس سرعة متجهة[1] — سرعة[1] رمز الوحدة mph (بالإنجليزية) ميل/س (بالعربية) mi/h (بالإنجليزية)[1] تحويلات الوحدةإلى النظام الدولي 0.44704 متر في الثانية[1] الوحدة القياسية 1.609343 كيلومتر في الس...

Collectible card game This article is about the card game. For the video game, see Pokémon Trading Card Game (video game). Pokémon Trading Card GamePokémon Trading Card Game logo (top) and cardbackDesignerTsunekazu Ishihara[1]Kouichi OoyamaTakumi AkabanePublisherThe Pokémon CompanyJapanMedia Factory(October 1996 – November 2000)United StatesWizards of the Coast(December 1998 – July 2003)Release dateOctober 20, 1996; 27 years ago (1996-10-20)TypeCollectiblePla...

 

Dit is een lijst van Duitse federale ministers van Voedsel, Landbouw en Consumentenbescherming en gelijkwaardige posten die daaraan voorafgingen. Ministers van Voedsel (1919 - 1945) Ministers van Voedsel # Minister Begin ambtstermijn Einde ambtstermijn Partij Kabinet(ten) 1 Robert Schmidt(1864–1943) 13 februari 1919 26 maart 1920 SPD Scheidemann, Bauer 2 Andreas Hermes(1878–1964) 27 maart 1920 10 maart 1922 ZENTRUM Müller I, Fehrenbach, Wirth I, Wirth II 3 Anton Fehr(1881–1954) 31 maar...

 

Sebuah Lagu untuk TuhanSutradara Alyandra Produser Hamdhani Koestoro Ferry Haryanto Ditulis oleh Rikrik El Saptaria Agnes Davonar PemeranStefan WilliamEriska ReinNina ZatuliniAdila FitriDewi YullBrigitta CynthiaTengku FirmansyahPiyuFirman MozaJennifer EvePenata musikTya SubyaktoPerusahaanproduksiFilm One ProductionsSafe CareTanggal rilisDurasi81 menitNegara IndonesiaBahasa Indonesia SekuelKomedi Gokil 2 Sebuah Lagu untuk Tuhan merupakan film drama Indonesia yang dirilis pada 29 Okt...

St Luke Passionby Krzysztof PendereckiPerformance at the Novaya Opera Theatre, Moscow, in 2016EnglishPassion and Death of Our Lord Jesus Christ According to St LukeFull titlePassio et mors Domini nostri Jesu Christi secundum LucamTextfrom Gospel of LukeStabat MaterhymnspsalmsLamentationsLanguageLatinPerformed30 March 1966 (1966-03-30)Scoringnarratorsopranobaritonebassthree choirschildren's choirorchestra The St Luke Passion (full title: Passio et mors Domini nostri Jesu Christi...

 

Artikel ini perlu diwikifikasi agar memenuhi standar kualitas Wikipedia. Anda dapat memberikan bantuan berupa penambahan pranala dalam, atau dengan merapikan tata letak dari artikel ini. Untuk keterangan lebih lanjut, klik [tampil] di bagian kanan. Mengganti markah HTML dengan markah wiki bila dimungkinkan. Tambahkan pranala wiki. Bila dirasa perlu, buatlah pautan ke artikel wiki lainnya dengan cara menambahkan [[ dan ]] pada kata yang bersangkutan (lihat WP:LINK untuk keterangan lebih lanjut...

 

International organisation representing naval architects Royal Institution of Naval ArchitectsFounded1860FounderEdward Reed, Rev Joseph Woolley, John Penn and Frederick Kynaston BarnesTypeProfessional InstitutionFocusNaval ArchitectsLocationLondon, United KingdomArea served WorldwideMethodInternational Membership, Conferences, PublicationsKey peopleChris Boyd (Chief Executive), Queen Elizabeth II (Patron)Websitewww.rina.org.uk The Royal Institution of Naval Architects (also known as RINA) is ...

2014 single by The Smashing PumpkinsOne and All (We Are)Single by The Smashing Pumpkinsfrom the album Monuments to an Elegy ReleasedNovember 5, 2014Recorded2014GenreNoise rock[1]Length3:46LabelBMG/Martha's MusicSongwriter(s)Billy CorganProducer(s) Billy Corgan Jeff Schroeder Howard Willing The Smashing Pumpkins singles chronology Being Beige (2014) One and All (We Are) (2014) Drum + Fife (2014) One and All (We Are) is the second single from The Smashing Pumpkins' tenth album Monuments...

 

River in Northeast China For the river in England, see River Nene. Nen RiverScene on the Nen RiverNative nameᠨᠣᠨ ᡠᠯᠠLocationCountryChinaRegionJilin, Heilongjiang, Inner MongoliaPhysical characteristicsSourceNen • locationHulunbuir, Inner Mongolia • coordinates51°20′06″N 124°29′31″E / 51.335°N 124.492°E / 51.335; 124.492 • elevation657 m (2,156 ft) MouthSonghua • locat...

 

Holy site for Abrahamic faiths King David's TombHebrew: קבר דוד המלךArabic: مقام النبي داودShown () within JerusalemAlternative nameMakam Nabi Daoud; CenacleLocationJerusalemCoordinates31°46′18″N 35°13′46″E / 31.77170°N 35.22936°E / 31.77170; 35.22936HistoryPeriodsLate Roman, Byzantine, Crusader, Mamluk, Ottoman, IsraelSite notesArchaeologistsJacob PinkerfeldPublic accessyes David's Tomb (Hebrew: קבר דוד המלך Kever...

Outdoor National Hockey League game 2020 NHL Winter Classic 123 Total Nashville Predators 200 2 Dallas Stars 013 4 DateJanuary 1, 2020VenueCotton BowlCityDallas, TexasAttendance85,630 ← 2019 2022 → The 2020 NHL Winter Classic was an outdoor ice hockey game played in the National Hockey League (NHL) on January 1, 2020, at the Cotton Bowl in Dallas, Texas. The 12th edition of the Winter Classic, it matched Dallas Stars against the Nashville Predators; the Stars won, 4–2....

 

Polish television series For the song, see Sexify (song). SexifyGenre Sex comedy Comedy drama Starring Sandra Drzymalska Aleksandra Skraba Maria Sobocińska Music byRadzimir DębskiCountry of originPolandOriginal languagePolishNo. of seasons2No. of episodes16ProductionRunning time37–51 minutesProduction companyAkson StudioOriginal releaseNetworkNetflixRelease29 April 2021 (2021-04-29) Sexify (stylized as Sex!fy) is a Polish sex comedy streaming television series directed by K...

 

German World War II torpedo boat Sister ship T21 at sea, 2 July 1946, en route to be scuttled with her load of poison gas History Nazi Germany NameT18 Ordered18 September 1937 BuilderSchichau, Elbing, East Prussia Yard number1406 Laid down27 July 1939 Launched1 June 1940 Completed22 November 1941 FateSunk by aircraft, 13 September 1944 General characteristics (as built) Class and typeType 37 torpedo boat Displacement 888 t (874 long tons) (standard) 1,139 t (1,121 long tons) (deep l...

Indian essayist (born 1951) M. RajendranBornMahadevan Rajendran (1951-03-03) 3 March 1951 (age 72)Annavasal, Tiruvarur, Tamil Nadu, IndiaOccupationTamil Nadu Government Officer Tamil University Vice Chancellor Writer JournalistGenreFiction, Tamil StudiesNotable awardsKalaingar Mu. Karunanidhi Classical Tamil Award, 2020 K. A. P. Vishwanatham AwardSpouseMythiliChildrenTenral and Ezhil M. Rajendran served as Vice-Chancellor of Tamil University, Thanjavur, in Tamil Nadu, India. He is a Tami...

 

University in Makhanda, South Africa Rhodes UniversityCoat of armsFormer namesRhodes University CollegeMottoWhere leaders learnTypePublicEstablished31 May 1904; 119 years ago (1904-05-31)EndowmentR429.6 million[1] (US$59.853 million as of 2008[update])ChancellorLex MpatiVice-ChancellorSizwe MabizelaAcademic staff357[2]Students7,005[2]Undergraduates5,372[2]Postgraduates1,633[2]LocationMakhanda, Eastern Cape, South Africa33°18...

 

Chemical compound ThienorphineClinical dataATC codeNoneIdentifiers IUPAC name (1R,2R,6S,15R)-3-(cyclopropylmethyl)-16-[(2R)-2-hydroxy-4-(thiophen-2-yl)butan-2-yl]-15-methoxy-13-oxa-3-azahexacyclo[13.2.2.12,8.01,6.06,14.07,12]icosa-7,9,11-trien-11-ol PubChem CID102212421ChemSpider58539334Chemical and physical dataFormulaC31H39NO4SMolar mass521.72 g·mol−13D model (JSmol)Interactive image SMILES C[C@@](CCc1cccs1)([C@H]2C[C@@]34CCC2([C@H]5[C@@]36CCN([C@@H]4Cc7c6c(c(cc7)O)O5)CC8CC8)OC)O In...

1987 film by Lawrence Bassoff This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Hunk film – news · newspapers · books · scholar · JSTOR (December 2011) (Learn how and when to remove this template message) HunkDVD coverDirected byLawrence BassoffWritten byLawrence BassoffProduced byMarilyn Jacobs TenserSta...

 

The name of this television reality uses a disambiguation style that does not follow WP:NCTV or WP:NCBC and needs attention. If you are removing this template without fixing the naming style to one supported by WP:NCTV, please add the article to Category:Television articles with disputed naming style. South Korean TV series or program VitaminGenreVarietyPresented byKim Tae-hoonLee Hwi-jaeCountry of originSouth KoreaOriginal languageKoreanNo. of episodes664 (as of March 9, 2017)Production...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!