MYLIP

MYLIP
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MYLIP, IDOL, MIR, myosin regulatory light chain interacting protein
Зовнішні ІД OMIM: 610082 MGI: 2388271 HomoloGene: 8309 GeneCards: MYLIP
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_013262
NM_153789
RefSeq (білок)
NP_037394
NP_722484
Локус (UCSC) Хр. 6: 16.13 – 16.15 Mb Хр. 13: 45.54 – 45.57 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYLIP (англ. Myosin regulatory light chain interacting protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 445 амінокислот, а молекулярна маса — 49 910[4].

Послідовність амінокислот
1020304050
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSK
GESLWLNLRNRISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHI
KEALLAGHLLCSPEQAVELSALLAQTKFGDYNQNTAKYNYEELCAKELSS
ATLNSIVAKHKELEGTSQASAEYQVLQIVSAMENYGIEWHSVRDSEGQKL
LIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLTVTKESGNSIV
LLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRNNQSPSHSP
LKSSESSMNCSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFC
PCGHTVCCESCAAQLQSCPVCRSRVEHVQHVYLPTHTSLLNLTVI

Кодований геном білок за функцією належить до трансфераз. Задіяний у таких біологічних процесах, як убіквітинування білків, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література

  • Olsson P.-A., Korhonen L., Mercer E.A., Lindholm D. (1999). MIR is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth. J. Biol. Chem. 274: 36288—36292. PMID 10593918 DOI:10.1074/jbc.274.51.36288
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Bornhauser B.C., Johansson C., Lindholm D. (2003). Functional activities and cellular localization of the ezrin, radixin, moesin (ERM) and RING zinc finger domains in MIR. FEBS Lett. 553: 195—199. PMID 14550572 DOI:10.1016/S0014-5793(03)01010-X
  • Bornhauser B.C., Olsson P.-A., Lindholm D. (2003). MSAP is a novel MIR-interacting protein that enhances neurite outgrowth and increases myosin regulatory light chain. J. Biol. Chem. 278: 35412—35420. PMID 12826659 DOI:10.1074/jbc.M306271200
  • Zelcer N., Hong C., Boyadjian R., Tontonoz P. (2009). LXR regulates cholesterol uptake through Idol-dependent ubiquitination of the LDL receptor. Science. 325: 100—104. PMID 19520913 DOI:10.1126/science.1168974

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:21155 (англ.) . Процитовано 6 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q8WY64 (англ.) . Архів оригіналу за 22 лютого 2018. Процитовано 6 вересня 2017.

Див. також

Read other articles:

Genus of fishes This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: Argentina fish – news · newspapers · books · scholar · JSTOR (December 2022) Argentina Greater Argentine (Argentina silus) Argentine (Argentina sphyraena) Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chord...

 

Daugbjerg Parochie van Denemarken Situering Bisdom Bisdom Viborg Gemeente Viborg Coördinaten 56°46'1,999NB, 9°7'49,001OL Algemeen Inwoners (2004) 483 Leden Volkskerk (2004) 432 Overig Kerken Daugbjerg Kirke Proosdij Viborg Domprovsti Pastoraat Daugbjerg-Mønsted-Smollerup Foto's Portaal    Denemarken Daugbjerg is een parochie van de Deense Volkskerk in de Deense gemeente Viborg. De parochie maakt deel uit van het bisdom Viborg en telt 432 kerkleden op een bevolking van 483 (2004)...

 

Panicum Panicum virgatumTumbuhanJenis buahKariopsis TaksonomiDivisiTracheophytaSubdivisiSpermatophytesKladAngiospermaeKladmonocotsKladcommelinidsOrdoPoalesFamiliPoaceaeSubfamiliPanicoideaeGenusPanicum Linnaeus, 1753 Tipe taksonomiPanicum miliaceum Tata namaSinonim takson Monachne P.Beauv. Eatonia Raf. Talasium Spreng. Phanopyrum (Raf.) Nash Chasea Nieuwl. Polyneura Peter 1930, illegitimate homonym not Kylin 1924 Psilochloa Launert Dichanthelium (Hitchc. & Chase) Gould Megathyrsus (Pi...

Politics of South Sudan Constitution Executive President Salva Kiir Mayardit Vice Presidents Riek Machar Taban Deng Gai James Wani Igga Rebecca Nyandeng De Mabior Hussein Abdelbagi Government Cabinet of South Sudan Legislature Council of States Speaker: Deng Deng Akon National Legislative Assembly Speaker: Jemma Nunu Kumba Judiciary Supreme Court Administrative divisions States and administrative areas Governors Counties Payam Cities Boma Elections Recent elections General: 20102024 Referendu...

 

Unter Geldmenge versteht man den Geld­bestand einer Volkswirtschaft einer bestimmten Bindungsdauer, der sich in Händen von Nichtbanken befindet.[1] Geldmengen können durch Geldschöpfung im Rahmen der Kreditvergabe durch Geschäftsbanken erhöht und durch die Tilgung von Krediten gesenkt werden. Bargeld oder Giralgeld sind stets Verbindlichkeiten einer Bank oder Zentralbank gegenüber einer Nichtbank. Mit zunehmender Bindungsdauer schwindet der Charakter der Verbindlichkeit als...

 

Miniature representation of Blastares  Matthew Blastares (Greek: Ματθαῖος Βλαστάρης or Βλάσταρις, romanized: Matthaios Blastares/Blastaris; fl. 1335–1346) was a 14th-century Byzantine Greek monk in Thessalonica and early scholarly opponent of reconciliation with Rome. He was also the writer of the Syntagma Canonum. Life Blastares was a hieromonk in the monastery of Kyr Isaac in Thessalonica, where he died after 1346.[1][2] Works He ...

هذه المقالة بحاجة لصندوق معلومات. فضلًا ساعد في تحسين هذه المقالة بإضافة صندوق معلومات مخصص إليها. يفتقر محتوى هذه المقالة إلى الاستشهاد بمصادر. فضلاً، ساهم في تطوير هذه المقالة من خلال إضافة مصادر موثوق بها. أي معلومات غير موثقة يمكن التشكيك بها وإزالتها. (يناير 2022) هذه مقا...

 

Fashion store & brand For other uses, see Biba (disambiguation). BibaTypePrivateIndustryFashionFoundedAugust 1964 (1964-08) (first store opens)FounderBarbara Hulanicki, Stephen Fitz-SimonDefunct1975 (1975)FateClosed by the British Land CompanyHeadquartersKensington, London, UKKey peopleBarbara Hulanicki, Stephen Fitz-Simon Biba was a London fashion store of the 1960s and 1970s. Biba was started and primarily run by the Polish-born Barbara Hulanicki with help of her husband ...

 

Indian singer (born 1969) This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This biographical article is written like a résumé. Please help improve it by revising it to be neutral and encyclopedic. (July 2016) This biography of a living person needs additional citations for verification. Please help by adding reliable sources. Contentious material about living persons that is unsourced or...

2013 Indian filmIvan VeramathiriFilm posterTamilஇவன் வேறமாதிரி Directed byM. SaravananWritten byM. SaravananProduced byN. Linguswamy (Presenter)N. Subash ChandraboseRonnie ScrewvalaSiddharth Roy KapurStarringVikram PrabhuSurbhiGanesh VenkatramanVamsi KrishnaHarirajCinematographyShakthiEdited byA. Sreekar PrasadMusic byC. SathyaProductioncompanyThirupathi BrothersDistributed byUTV Motion PicturesRelease date 13 December 2013 (2013-12-13) Running time153...

 

Seorang Bohemia Eugène Siberdt, Eugeen Siberdt atau Eugène François Joseph Siberdt[1] (21 April 1851 – 6 Januari 1931) adalah seorang pelukis akhir-Romantik Akademik asal Belgia yang membuat potret, lukisan sejarah, pemandangan genre dan lukisan Orientalis.[2] Ia sekarang dikenal sebagai profesor gambar di Akademi Antwerp yang berkonflik dengan Vincent van Gogh yang membuat van Gogh meninggalkan Akademi Antwerp setelah hanya tiga bulan hadir.[3] Refe...

 

Saltos en los Juegos Olímpicos de Tokio 2020 Centro Acuático de TokioDatos generalesSede TokioJapón JapónRecinto Centro Acuático de TokioFecha 25 de julio – 7 de agosto de 2021Organizador COI y FINAParticipantes 136 Cronología Río de Janeiro 2016 Tokio 2020 París 2024 Sitio oficial [editar datos en Wikidata] Las competiciones de saltos en los Juegos Olímpicos de Tokio 2020 se realizaron en el Centro Acuático de Tokio del 25 de julio al 7 de agosto de 2021.[1]​...

Building on the Southern Illinois University Carbondale campus Faner HallGeneral informationTypeEducationalArchitectural styleBrutalist architectureLocationSouthern Illinois University CarbondaleAddress1000 Faner DriveCarbondale, Illinois 62901Coordinates37°42′54″N 89°13′08″W / 37.715°N 89.219°W / 37.715; -89.219Current tenantsSIUC College of Liberal ArtsUniversity MuseumCompleted1974[1]Cost$12.75 millionOwnerSouthern Illinois University CarbondaleD...

 

For the current competition, see 2023 Rogue Invitational. Rogue InvitationalTournament informationSportCrossFitStrongmanLocation United StatesEstablished2019; 4 years ago (2019)Number oftournaments3FormatMulti-event competitionPurse$1.4 million (2021)[1]WebsiteRogue InvitationalCurrent championCrossFit men: Patrick VellnerCrossFit women: Laura HorvathStrongman: Mitchell HooperMost recent tournament2023 Rogue Invitational The Rogue Invitational is an annual sport...

 

جزء من سلسلة مقالات عناليهودية التاريخ الخط الزمني الخروج زمن الملكية زمن السبي المحرقة إسرائيل تاريخ اليهودية التقويم العقائد الله أسماء الله يهوه إل) الوصايا العشر الشعب المختار الأنبياء مشيح نجمة داود النصوص التناخ التوراة الأسفار المقدسة قبالة هالاخاه التلمود شخصيا...

Highway in Connecticut and Massachusetts Route 159Route 159 highlighted in redRoute informationMaintained by CTDOTLength21.14 mi[1] (34.02 km)Connecticut: 16.82 mi[1]Massachusetts: 4.32 mi[2]ExistedOctober 1968[3]–presentMajor junctionsSouth endMain Street (near I-91) at the Hartford-Windsor town lineMajor intersections I-291 in Windsor, CT I-91 in Windsor Locks, CT Route 57 in Agawam, MANorth end Route 75 / Route&...

 

A referendum on the purchase of paintings by Pablo Picasso in Basel, Switzerland Two Brothers (1905); one of the subjects of the referendum, which remain on display in the Kunstmuseum Basel In the 1967 Basel Picasso paintings purchase referendum, the people of Basel, Switzerland, voted for the purchase of two paintings by Pablo Picasso, Les deux frères (1906) and Arlequin assis (1923). The referendum took place on 17 December 1967, and the yes campaign was supported by the youth of Basel and...

 

 TV series or program Under the VeilOfficial posterAlso known asDouble Fantasies無雙譜GenrePeriod drama, Romance, FantasyCreated byHong Kong Television Broadcasts LimitedWritten byCheung Chung-yanDirected byLeung Yiu-kin, Cheng Wing-kei, Kwow Ka-hei, Lui Sui-lunStarringWayne LaiBosco WongRaymond WongSonija KwokKristal TinEliza SamKaty KungJoseph LeeTheme music composerAlan CheungOpening themeOne and Only (獨一無二) by Vincy ChanCountry of originHong Kong, ChinaOriginal languageCan...

Public school district in Avoca, Iowa, United States 41°28′10″N 95°20′30″W / 41.469562°N 95.341800°W / 41.469562; -95.341800 AHSTW Community School DistrictLocation[Avoca, Iowa]Cass, Harrison, Pottawattamie, and Shelby counties United StatesCoordinates41.469562, -95.341800District informationTypeLocal school districtGradesK-12Established2016SuperintendentDarin JonesSchools1Budget$12,000,000(2017-18)[1]NCES District ID1904080[1]Students and s...

 

Millicent Tanner Plaats uw zelfgemaakte foto hier Persoonlijke informatie Volledige naam Millicent Jane Lewis Tanner Geboortedatum 10 januari 1999 Sportieve informatie Specialisatie(s) baanwielrennen Portaal    Wielersport Millicent Jane Lewis Tanner (10 januari 1999) is een Britse baanwielrenster. Tanner was in haar jeugd zwemster voordat ze in 2017 de overstap naar het baanwielrennen maakte. Tijdens de Europese kampioenschappen baanwielrennen in 2020 behaalde ze met de Britse plo...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!