Tautology (logic)

In mathematical logic, a tautology (from Ancient Greek: ταυτολογία) is a formula that is true regardless of the interpretation of its component terms, with only the logical constants having a fixed meaning. For example, a formula that states, "the ball is green or the ball is not green," is always true, regardless of what a ball is and regardless of its colour. Tautology is usually, though not always, used to refer to valid formulas of propositional logic.

The philosopher Ludwig Wittgenstein first applied the term to redundancies of propositional logic in 1921, borrowing from rhetoric, where a tautology is a repetitive statement. In logic, a formula is satisfiable if it is true under at least one interpretation, and thus a tautology is a formula whose negation is unsatisfiable. In other words, it cannot be false.

Unsatisfiable statements, both through negation and affirmation, are known formally as contradictions. A formula that is neither a tautology nor a contradiction is said to be logically contingent. Such a formula can be made either true or false based on the values assigned to its propositional variables.

The double turnstile notation is used to indicate that S is a tautology. Tautology is sometimes symbolized by "Vpq", and contradiction by "Opq". The tee symbol is sometimes used to denote an arbitrary tautology, with the dual symbol (falsum) representing an arbitrary contradiction; in any symbolism, a tautology may be substituted for the truth value "true", as symbolized, for instance, by "1".[1]

Tautologies are a key concept in propositional logic, where a tautology is defined as a propositional formula that is true under any possible Boolean valuation of its propositional variables.[2] A key property of tautologies in propositional logic is that an effective method exists for testing whether a given formula is always satisfied (equiv., whether its negation is unsatisfiable).

The definition of tautology can be extended to sentences in predicate logic, which may contain quantifiers—a feature absent from sentences of propositional logic. Indeed, in propositional logic, there is no distinction between a tautology and a logically valid formula. In the context of predicate logic, many authors define a tautology to be a sentence that can be obtained by taking a tautology of propositional logic, and uniformly replacing each propositional variable by a first-order formula (one formula per propositional variable). The set of such formulas is a proper subset of the set of logically valid sentences of predicate logic (i.e., sentences that are true in every model).

History

The word tautology was used by the ancient Greeks to describe a statement that was asserted to be true merely by virtue of saying the same thing twice, a pejorative meaning that is still used for rhetorical tautologies. Between 1800 and 1940, the word gained new meaning in logic, and is currently used in mathematical logic to denote a certain type of propositional formula, without the pejorative connotations it originally possessed.

In 1800, Immanuel Kant wrote in his book Logic:

The identity of concepts in analytical judgments can be either explicit (explicita) or non-explicit (implicita). In the former case analytic propositions are tautological.

Here, analytic proposition refers to an analytic truth, a statement in natural language that is true solely because of the terms involved.

In 1884, Gottlob Frege proposed in his Grundlagen that a truth is analytic exactly if it can be derived using logic. However, he maintained a distinction between analytic truths (i.e., truths based only on the meanings of their terms) and tautologies (i.e., statements devoid of content).

In his Tractatus Logico-Philosophicus in 1921, Ludwig Wittgenstein proposed that statements that can be deduced by logical deduction are tautological (empty of meaning), as well as being analytic truths. Henri Poincaré had made similar remarks in Science and Hypothesis in 1905. Although Bertrand Russell at first argued against these remarks by Wittgenstein and Poincaré, claiming that mathematical truths were not only non-tautologous but were synthetic, he later spoke in favor of them in 1918:

Everything that is a proposition of logic has got to be in some sense or the other like a tautology. It has got to be something that has some peculiar quality, which I do not know how to define, that belongs to logical propositions but not to others.

Here, logical proposition refers to a proposition that is provable using the laws of logic.

Many logicians in the early 20th century used the term 'tautology' for any formula that is universally valid, whether a formula of propositional logic or of predicate logic. In this broad sense, a tautology is a formula that is true under all interpretations, or that is logically equivalent to the negation of a contradiction. Tarski and Gödel followed this usage and it appears in textbooks such as that of Lewis and Langford.[3] This broad use of the term is less common today, though some textbooks continue to use it. [4] [5]

Modern textbooks more commonly restrict the use of 'tautology' to valid sentences of propositional logic, or valid sentences of predicate logic that can be reduced to propositional tautologies by substitution. [6] [7]

Background

Propositional logic begins with propositional variables, atomic units that represent concrete propositions. A formula consists of propositional variables connected by logical connectives, built up in such a way that the truth of the overall formula can be deduced from the truth or falsity of each variable. A valuation is a function that assigns each propositional variable to either T (for truth) or F (for falsity). So by using the propositional variables A and B, the binary connectives and representing disjunction and conjunction respectively, and the unary connective representing negation, the following formula can be obtained:.

A valuation here must assign to each of A and B either T or F. But no matter how this assignment is made, the overall formula will come out true. For if the first disjunct is not satisfied by a particular valuation, then A or B must be assigned F, which will make one of the following disjunct to be assigned T. In natural language, either both A and B are true or at least one of them is false.

Definition and examples

A formula of propositional logic is a tautology if the formula itself is always true, regardless of which valuation is used for the propositional variables. There are infinitely many tautologies.

In many of the following examples A represents the statement "object X is bound", B represents "object X is a book", and C represents "object X is on the shelf". Without a specific referent object X, corresponds to the proposition "all bound things are books".

  • ("A or not A"), the law of excluded middle. This formula has only one propositional variable, A. Any valuation for this formula must, by definition, assign A one of the truth values true or false, and assign A the other truth value. For instance, "The cat is black or the cat is not black".
  • ("if A implies B, then not-B implies not-A", and vice versa), which expresses the law of contraposition. For instance, "If it's bound, it is a book; if it's not a book, it's not bound" and vice versa.
  • ("if not-A implies both B and its negation not-B, then not-A must be false, then A must be true"), which is the principle known as reductio ad absurdum. For instance, "If it's not bound, we know it's a book, if it's not bound, we know it's also not a book, so it is bound".
  • ("if not both A and B, then not-A or not-B", and vice versa), which is known as De Morgan's law. "If it is not both a book and bound, then we are sure that it's not a book or that it's not bound" and vice versa.
  • ("if A implies B and B implies C, then A implies C"), which is the principle known as hypothetical syllogism. "If it's bound, then it's a book and if it's a book, then it's on that shelf, so if it's bound, it's on that shelf".
  • ("if at least one of A or B is true, and each implies C, then C must be true as well"), which is the principle known as proof by cases. "Bound things and books are on that shelf. If it's either a book or it's blue, it's on that shelf".

A minimal tautology is a tautology that is not the instance of a shorter tautology.

  • is a tautology, but not a minimal one, because it is an instantiation of .

Verifying tautologies

The problem of determining whether a formula is a tautology is fundamental in propositional logic. If there are n variables occurring in a formula then there are 2n distinct valuations for the formula. Therefore, the task of determining whether or not the formula is a tautology is a finite and mechanical one: one needs only to evaluate the truth value of the formula under each of its possible valuations. One algorithmic method for verifying that every valuation makes the formula to be true is to make a truth table that includes every possible valuation.[2]

For example, consider the formula

There are 8 possible valuations for the propositional variables A, B, C, represented by the first three columns of the following table. The remaining columns show the truth of subformulas of the formula above, culminating in a column showing the truth value of the original formula under each valuation.

T T T T T T T T
T T F T F F F T
T F T F T T T T
T F F F T T T T
F T T F T T T T
F T F F T F T T
F F T F T T T T
F F F F T T T T

Because each row of the final column shows T, the sentence in question is verified to be a tautology.

It is also possible to define a deductive system (i.e., proof system) for propositional logic, as a simpler variant of the deductive systems employed for first-order logic (see Kleene 1967, Sec 1.9 for one such system). A proof of a tautology in an appropriate deduction system may be much shorter than a complete truth table (a formula with n propositional variables requires a truth table with 2n lines, which quickly becomes infeasible as n increases). Proof systems are also required for the study of intuitionistic propositional logic, in which the method of truth tables cannot be employed because the law of the excluded middle is not assumed.

Tautological implication

A formula R is said to tautologically imply a formula S if every valuation that causes R to be true also causes S to be true. This situation is denoted . It is equivalent to the formula being a tautology (Kleene 1967 p. 27).

For example, let be . Then is not a tautology, because any valuation that makes false will make false. But any valuation that makes true will make true, because is a tautology. Let be the formula . Then , because any valuation satisfying will make true—and thus makes true.

It follows from the definition that if a formula is a contradiction, then tautologically implies every formula, because there is no truth valuation that causes to be true, and so the definition of tautological implication is trivially satisfied. Similarly, if is a tautology, then is tautologically implied by every formula.

Substitution

There is a general procedure, the substitution rule, that allows additional tautologies to be constructed from a given tautology (Kleene 1967 sec. 3). Suppose that S is a tautology and for each propositional variable A in S a fixed sentence SA is chosen. Then the sentence obtained by replacing each variable A in S with the corresponding sentence SA is also a tautology.

For example, let S be the tautology:

.

Let SA be and let SB be .

It follows from the substitution rule that the sentence:

is also a tautology.

Semantic completeness and soundness

An axiomatic system is complete if every tautology is a theorem (derivable from axioms). An axiomatic system is sound if every theorem is a tautology.

Efficient verification and the Boolean satisfiability problem

The problem of constructing practical algorithms to determine whether sentences with large numbers of propositional variables are tautologies is an area of contemporary research in the area of automated theorem proving.

The method of truth tables illustrated above is provably correct – the truth table for a tautology will end in a column with only T, while the truth table for a sentence that is not a tautology will contain a row whose final column is F, and the valuation corresponding to that row is a valuation that does not satisfy the sentence being tested. This method for verifying tautologies is an effective procedure, which means that given unlimited computational resources it can always be used to mechanistically determine whether a sentence is a tautology. This means, in particular, the set of tautologies over a fixed finite or countable alphabet is a decidable set.

As an efficient procedure, however, truth tables are constrained by the fact that the number of valuations that must be checked increases as 2k, where k is the number of variables in the formula. This exponential growth in the computation length renders the truth table method useless for formulas with thousands of propositional variables, as contemporary computing hardware cannot execute the algorithm in a feasible time period.

The problem of determining whether there is any valuation that makes a formula true is the Boolean satisfiability problem; the problem of checking tautologies is equivalent to this problem, because verifying that a sentence S is a tautology is equivalent to verifying that there is no valuation satisfying . The Boolean satisfiability problem is NP-complete, and consequently, tautology is co-NP-complete. It is widely believed that (equivalently for all NP-complete problems) no polynomial-time algorithm can solve the satisfiability problem, although some algorithms perform well on special classes of formulas, or terminate quickly on many instances.[8]

Tautologies versus validities in first-order logic

The fundamental definition of a tautology is in the context of propositional logic. The definition can be extended, however, to sentences in first-order logic.[9] These sentences may contain quantifiers, unlike sentences of propositional logic. In the context of first-order logic, a distinction is maintained between logical validities, sentences that are true in every model, and tautologies (or, tautological validities), which are a proper subset of the first-order logical validities. In the context of propositional logic, these two terms coincide.

A tautology in first-order logic is a sentence that can be obtained by taking a tautology of propositional logic and uniformly replacing each propositional variable by a first-order formula (one formula per propositional variable). For example, because is a tautology of propositional logic, is a tautology in first order logic. Similarly, in a first-order language with a unary relation symbols R,S,T, the following sentence is a tautology:

It is obtained by replacing with , with , and with in the propositional tautology: .

Not all logical validities are tautologies in first-order logic. For example, the sentence:

is true in any first-order interpretation, but it corresponds to the propositional sentence which is not a tautology of propositional logic.

Tautologies in Non-Classical Logics

Whether a given formula is a tautology depends on the formal system of logic that is in use. For example, the following formula is a tautology of classical logic but not of intuitionistic logic:

See also

Normal forms

References

  1. ^ Weisstein, Eric W. "Tautology". mathworld.wolfram.com. Retrieved 2020-08-14.
  2. ^ a b "tautology | Definition & Facts". Encyclopedia Britannica. Retrieved 2020-08-14.
  3. ^ Lewis, C I; Langford, C H (1959). Symbolic Logic (2nd ed.). Dover.
  4. ^ Hedman, Shawn (2004). A First Course in Logic. Oxford University Press. p. 63.
  5. ^ Rautenberg, Wolfgang (2010). A Concise Introduction to Mathematical Logic. Springer. p. 64.
  6. ^ Enderton, Herbert (2001). Mathematical Introduction to Logic. Academic Press. p. 88.
  7. ^ Hinman, Peter (2010). Fundamentals of Mathematical Logic. Springer. p. 98.
  8. ^ See SAT solver for references.
  9. ^ "New Members". Naval Engineers Journal. 114 (1): 17–18. January 2002. doi:10.1111/j.1559-3584.2002.tb00103.x. ISSN 0028-1425.

Further reading

Read other articles:

American historian (born 1946) William C. DavisDavis at the 2015 Gaithersburg Book Festival.BornWilliam Charles Davis1946 (age 76–77)Independence, Missouri, U.S.NationalityAmericanOther namesW.C. DavisEducationMaster of Arts in History (1969)Alma materSonoma State UniversityOccupationHistorianKnown forStudies of the American Civil WarNotable workThe Cause Lost: Myths and Realities of the Confederacy (1996)Websitecivilwar.vt.edu William Charles Jack Davis (born 1946) ...

 

Santo Estevo do Castro de AmaranteCastro de Amarante Parroquia de GaliciaAldea Iglesia de San Esteban Santo Estevo do Castro de AmaranteLocalización de Santo Estevo do Castro de Amarante en España Santo Estevo do Castro de AmaranteLocalización de Santo Estevo do Castro de Amarante en Lugo Coordenadas 42°46′37″N 7°55′06″O / 42.77698107, -7.91840958Entidad Parroquia de GaliciaAldea • País  España • Comunidad autónoma Galicia • Provincia ...

 

Союз порятунку РумуніїUniunea Salvați România Країна  РумуніяГолова партії Cătălin DrulădЗасновник Nicușor DandДата заснування 1 липня 2015 рокуШтаб-квартира БухарестІдеологія Центризм; універсалізм, синкретизмОфіційний сайт usr.ro/%20usr.ro Союз порятунку Румунії (рум. Uniunea Salvați România; USR)&#...

Gilbert White Gilbert White Nascimento 18 de julho de 1720Selborne (Reino da Grã-Bretanha) Morte 26 de junho de 1793 (72 anos)Selborne (Reino da Grã-Bretanha) Cidadania Reino da Grã-Bretanha Irmão(ã)(s) Thomas Holt White, Benjamin White Alma mater Oriel CollegeQueen Mary's School for Boys, Basingstoke Ocupação botânico, ornitólogo, ecologista, sacerdote, escritor, naturalista Empregador(a) Universidade de Oxford Obras destacadas The Natural History and Antiquities of Selborne Rel...

 

Voor de groep afwijkende seksuele voorkeuren, zie Parafilie Het ontbreken van Aves maakt Reptilia parafyletisch Een parafyletische groep is een taxon waarbij de laatste gemeenschappelijke voorouder van een groep organismen zelf wel tot dat taxon behoort, maar niet alle afstammelingen ervan in de groep geplaatst zijn. Als de laatste gemeenschappelijke voorouder van een groep organismen zelf niet tot dat taxon behoort, dan betreft het een polyfyletische groep. Een goed voorbeeld van een parafyl...

 

El nacionalismo afrikáner (afrikáans: Afrikaner Volkseenheid) es una ideología política que nació en el siglo XIX sobre la idea que los afrikáneres en Sudáfrica eran un «pueblo elegido»; la ideología estaba muy influida por fuertes sentimientos anti-británicos que se desarrollaron entre los afrikáneres, especialmente a causa de las Guerras de los Bóeres.[1]​ El nacionalismo afrikáner enfatizaba la unidad de todos los afrikáneres. Según el historiador T. Dunbar Moodi...

公益財団法人吉田記念テニス研修センター団体種類 公益財団法人設立 1988年(昭和63年)2月23日所在地 千葉県柏市花野井936番地1法人番号 5040005014441 活動内容 テニスを普及するためのスクール事業およびイベント開催 等ウェブサイト www.tennis-ttc.or.jpテンプレートを表示 座標: 北緯35度53分48.4秒 東経139度58分24.3秒 / 北緯35.896778度 東経139.973417度 / 35.896778; 1...

 

Belgium cabinet of 2011–2014 Di Rupo Government93rd Cabinet of Belgium (since 1830)Date formed6 December 2011Date dissolved11 October 2014People and organisationsHead of stateAlbert II of BelgiumPhilippe of BelgiumHead of governmentElio Di RupoDeputy head of government See list Pieter De Crem (Defence)Didier Reynders (Foreign Affairs, Foreign Trade and European Affairs)Johan Vande Lanotte (Economy, Consumer Affairs and the North Sea)Alexander De Croo (Pensions)Joëlle Milquet (Interior)Laur...

 

Israeli whistleblower and journalist Anat Kam (2008) Anat Kamm (alternative spelled Anat Kam, Hebrew: ענת קם; born in 1987 in Jerusalem) is an Israeli journalist and former whistleblower known for her role in the Anat Kamm–Uri Blau affair. Life Born in Jerusalem in 1987,[1] Kamm attended Hebrew University Secondary School. She became interested in journalism in her youth, writing for the local newspaper Jerusalem (formerly Yedioth Jerusalem), as well as for the youth channel of...

Kontributor utama artikel ini tampaknya memiliki hubungan dekat dengan subjek. Artikel ini mungkin memerlukan perapian untuk mematuhi kebijakan konten Wikipedia, terutama dalam hal sudut pandang netral. Silakan dibahas lebih lanjut di halaman pembicaraan artikel ini. Drs. RadenMohammad ZuhdanLahirMohammad Zuhdan(1931-09-03)3 September 1931Kauman, Yogyakarta, Hindia BelandaMeninggal24 Juni 1986(1986-06-24) (umur 54)Bukittinggi, Sumatera Barat, IndonesiaKebangsaanIndonesiaAlmamaterIKIP Yog...

 

Species of plume moth Oxyptilus causodes Oxyptilus causodes, Queensland Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Arthropoda Class: Insecta Order: Lepidoptera Family: Pterophoridae Genus: Oxyptilus Species: O. causodes Binomial name Oxyptilus causodesMeyrick, 1905 Oxyptilus causodes is a moth of the family Pterophoridae. It is known from India, Sri Lanka, Myanmar and was recently discovered in New Guinea[1] and Australia.[2] The wingspan is abo...

 

Rin Takanashi (高梨 臨)Rin Takanashi (2013)Lahir17 Desember 1988 (umur 34) Prefektur Chiba, JepangPekerjaanAktrisSitus webProfil resmi di Rin Takanashi (dari Stardust Promotion) Rin Takanashi (高梨 臨code: ja is deprecated , Takanashi Rin, lahir 17 Desember 1988) adalah aktris dan talent asal Jepang. Ia mulai berkarier di dunia artis sejak tahun 2005. Rin Takanashi sekarang berada di bawah manajemen artis Stardust Promotion. Biografi Tahun 2005 merupakan tahun debut Takanashi sebag...

Norwegian painter (1863–1944) For the film, see Edvard Munch (film). Edvard MunchMunch in an undated photoBorn(1863-12-12)12 December 1863Ådalsbruk, Løten, Sweden–NorwayDied23 January 1944(1944-01-23) (aged 80)Oslo, NorwayNationalityNorwegianKnown forPainting and graphic artistNotable work The Scream Madonna The Sick Child MovementExpressionism, Symbolism Edvard Munch (/mʊŋk/ MUUNK,[1] Norwegian: [ˈɛ̀dvɑɖ ˈmʊŋk] ⓘ; 12 December 1863 – 23 January 19...

 

Indian dynasty (c. 225 – c.340) For other uses, see Ikshvaku (disambiguation). Ikshvakus of VijayapuriEarly 3rd century–early 4th centurySouth Asia350 CEYAUDHEYASARJUNAYANASMADRAKASMALAVASIKSHVAKUSKALABHRASWESTERNGANGASTOCHARIANSKADAMBASPALLAVASLITTLEKUSHANSLICCHAVISWESTERNSATRAPSSASANIANHINDMAHAMEGHA-VAHANASKAMARUPAGAUDASAMATATASDAVAKAKIDARITESABHIRASVAKATAKASGUPTAEMPIREKUSHANO-SASANIANSSAKASTANTURANMAKRANSASANIANEMPIRE  ◁ ▷ Location of the Andhra Ikshvakus in c. 350 CECapitalVi...

 

Artist's book by Edward Ruscha Twentysix Gasoline Stations AuthorEd RuschaCountryUSLanguageEnglishGenreArtists' booksPublisherNational Excelsior PressPublication date1963Media typeBookPages48OCLC20409845 Twentysix Gasoline Stations is the first artist's book by the American pop artist Ed Ruscha. Published in April 1963[1] on his own imprint National Excelsior Press,[2] it is often considered to be the first modern artist's book,[3] and has become famous as a precu...

Bangladeshi political party Bangladesh Muslim League বাংলাদেশ মুসলিম লীগ PresidentAdv. Badrudozza Ahmed SujaGeneral SecretaryKazi Abul KhairFounded30 December 1906 in Shahbag, Dhaka (as All-India Muslim League) Re-organized in Bangladesh: 8 August 1976IdeologyMuslim nationalismPolitical positionRight-wing to far-rightReligionIslamElection symbolPolitics of BangladeshPolitical partiesElectionsA recent Working Committee meeting of Bangladesh Muslim Le...

 

Railroad in the United States (1866-1890) Jeffersonville, Madison and Indianapolis RailroadOverviewHeadquartersIndianapolis, IndianaLocaleIndianaDates of operation1866–1890PredecessorIndianapolis and Madison RailroadJeffersonvile RailroadSuccessorPittsburgh, Cincinnati and St. Louis RailwayTechnicalTrack gauge4 ft 8+1⁄2 in (1,435 mm) standard gauge The Jeffersonville, Madison and Indianapolis Railroad (JM&I) was formed in 1866 as a merger between the Indian...

 

Contemporary R&B division of Def Jam Records Def Soul RecordsThe New Soul of R&B FlavorThe Island Def Jam Music Groupa Universal Music companyParent companyUniversal Music GroupFounded1996; 27 years ago (1996)FounderRussell SimmonsKevin LilesDefunct2011 (2011)StatusFoldedDistributor(s)Def Jam Recordings (United States)Mercury Records (United Kingdom)Universal Music Group (International)Universal Music Enterprises (reissues)Genre Contemporary R&B soul neo sou...

Voce principale: Delfino Pescara 1936. Pescara CalcioStagione 1981-1982 Sport calcio Squadra Pescara Allenatore Saul Malatrasi (1ª-4ª) Mario Tiddia (5ª-16ª) Giuseppe Chiappella (17ª-38ª) Presidente Vincenzo Marinelli Serie B20º (retrocesso in Serie C1) Coppa ItaliaPrimo turno Maggiori presenzeCampionato: D'Alessandro (38) Miglior marcatoreCampionato: Amenta, Mazzarri (4) 1980-1981 1982-1983 Si invita a seguire il modello di voce Questa voce raccoglie le informazioni riguardanti il...

 

1868 opera by Richard Wagner Die Meistersinger von NürnbergMusic drama by Richard WagnerMax Staegemann (1843–1905) as Hans SachsTranslationThe Mastersingers of NurembergLibrettistRichard WagnerLanguageGermanPremiere21 June 1868 (1868-06-21)National Theatre Munich in Munich Die Meistersinger von Nürnberg (German: [diː ˈmaɪstɐˌzɪŋɐ fɔn ˈnʏʁnbɛːɐk]; The Master-Singers of Nuremberg), WWV 96, is a music drama, or opera, in three acts, by Richard Wagner. It...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!