Read other articles:

Type of editorial tactic used in mass media Causes of death in the US vs media coverage. The percentage of media attention for terrorism, homicide or suicide is much greater than the percentage of deaths caused by it. Journalism News Writing style Ethics code of ethics Objectivity News values Attribution Defamation Sensationalism Editorial independence Journalism school Index of journalism articles Areas Arts Business Data Entertainment Environment Fashion Medicine Music Politics Science Spor...

Politics of Kansas Constitution United States Constitution Kansas Constitution Executive Government Governor: Laura Kelly (D) Lieutenant Governor: David Toland (R) Secretary of State: Scott Schwab (R) Attorney General: Derek Schmidt (R) State Treasurer: Lynn Rogers (D) Insurance Commissioner: Vicki Schmidt (R) Corporation Commission State Cabinet Legislature Legislature: Kansas Legislature Senate President: Ty Masterson (R) Vice President: Rick Wilborn (R) Majority Leader: Larry Alley (R) Min...

Turkish chess player (born 1991) Kübra ÖztürkÖztürk at the 2008 World Junior Chess Championship in Gaziantep, TurkeyCountryTurkeyBorn (1991-05-11) May 11, 1991 (age 32)Mamak, Ankara, TurkeyTitleWoman Grandmaster (2012)Peak rating2364 (September 2017) Kübra Öztürk (born May 11, 1991) is a Turkish chess player. As of the July 2012 FIDE rating list, she is ranked number 199 in the world and second in Turkey among female active players. She earned FIDE titles as Woman FIDE Maste...

186th Air Refueling Wing186th Air Refueling Wing KC-135Active1962–presentCountry United StatesAllegiance MississippiBranch  Air National GuardTypeWingRoleAir RefuelingSizeAbout 1200Part ofMississippi Air National GuardGarrison/HQKey Field Air National Guard Base, Meridian Regional AirportDecorationsAir Force Outstanding Unit AwardCommandersCurrentcommanderColonel Cynthia SmithInsignia186th Air Refueling Wing emblem186th Tactical Reconnaissance Group emblemTail StripeMili...

Geladak kapal Falls of Clyde terbuat dari baja dan di tengah dilapisi kayu, merupakan desain yang umum digunakan pada abad ke-19 Geladak (bahasa Inggris: deck) adalah lantai kapal, nama – nama geladak ini tergantung dari banyaknya geladak yang ada di kapal tersebut. Pada umumnya geladak yang berada di paling bawah dinamakan geladak dasar serta geladak yang di atas dinamakan geladak atas atau geladak utama (main deck). Bila antara geladak dasar dan geladak atas terdapat geladak, maka geladak...

Esta página cita fontes, mas que não cobrem todo o conteúdo. Ajude a inserir referências. Conteúdo não verificável pode ser removido.—Encontre fontes: ABW  • CAPES  • Google (N • L • A) (Outubro de 2019) Cristo Redentor   Bairro do Brasil   Localização Município Porto Alegre Características geográficas Área total 148 hectares População total 16,103 hab (2 000)7,218 homens8,885 mulheres hab....

Cet article donne la liste des héritiers du trône d'Espagne depuis la fondation du royaume d'Espagne en 1516. Les règles de succession incluent la primogéniture cognatique avec préférence masculine, même si la loi salique a été introduite entre 1713 et 1830 par la maison de Bourbon-Anjou. Les héritiers mâles portent le titre de prince des Asturies, créé en 1388 sur décision du roi Jean Ier de Castille en faveur du premier descendant du monarque, avec préférence masculine. List...

Parte da série sobrePolítica de Bangladesh Constituição Executivo Presidente - Abdul Hamid Primeira-ministra - Sheikh Hasina Legislativo Jatiyo Sangshad Judiciário Suprema Corte Eleições Eleições gerais - 2008 · 2014 Subdivisões regionais Distritos Subdistritos Tópicos relacionados Missões diplomáticas Portal de Bangladeshvde Ver também vdePredefinições de política da ÁsiaEstadossoberanos Afeganistão · Arábia Saudita · Arménia1 · Azerbaijã...

Đối với các định nghĩa khác, xem Hòa Sơn. Hòa Sơn Xã Xã Hòa Sơn UBND xã Hòa SơnHành chínhQuốc gia Việt NamVùngDuyên hải Nam Trung BộThành phốĐà NẵngHuyệnHòa VangTrụ sở UBNDĐường Âu CơTổ chức lãnh đạoChủ tịch UBNDNguyễn Duy PhươngChủ tịch HĐNDNguyễn Thị HuệChủ tịch UBMTTQPhạm Đình PhiBí thư Đảng ủyLê Đức TríĐịa lýTọa độ: 16°02′53″B 108°06′28″Đ / 16,04805°B 1...

Protein domain Crystallographic structure of the SH2 domain. The structure consists of a large beta sheet (green) flanked by two alpha-helices (orange and blue).[1]IdentifiersSymbolSH2PfamPF00017InterProIPR000980SMARTSH2PROSITEPDOC50001SCOP21sha / SCOPe / SUPFAMCDDcd00173Available protein structures:Pfam  structures / ECOD  PDBRCSB PDB; PDBe; PDBjPDBsumstructure summary The SH2 (Src Homology 2) domain is a structurally conserved protein domain contained within the Src oncopr...

See also: List of universities in Indonesia This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: List of Indonesian agricultural universities and colleges – news · newspapers · books · scholar · JSTOR (October 2012) (Learn how and when to remove this template message) Agricultural training institute, Bogor, 1920-...

Indonesia Creators Economy (ICE)JenisAnak perusahaanPendahuluIDN Creator NetworkDidirikan8 Maret 2017; 6 tahun lalu (2017-03-08) (sebagai IDN Creator Network)8 Maret 2022; 20 bulan lalu (2022-03-08) (sebagai Indonesia Creator Economy)Ditutup08 Maret 2022 (2022-03-08) (sebagai IDN Creator Network)KantorpusatJakarta, IndonesiaWilayah operasiIndonesiaPemilikIDN MediaSitus webhttps://www.ice.id/ Indonesia Creators Economy (ICE) merupakan marketplace kreator konten dari Indonesia mi...

Trenton Hassell Trenton Hassell con New Jersey Nets en 2009.Datos personalesNombre completo Trenton Lavar HassellNacimiento Clarksville, Tennessee  Estados Unidos4 de marzo de 1979 (44 años)Nacionalidad(es) EstadounidenseAltura 1,96 m (6′ 5″)Peso 106 kg (233 lb)Carrera deportivaDeporte BaloncestoEquipo universitario Austin Peay (1997-2001)Club profesionalDraft de la NBA 2.ª ronda (puesto 30) 2001 por Chicago BullsClub RetiradoPosición AleroDorsal(es) 22, 44, 23...

This article is about the city hall in the United Kingdom. For the city hall in Australia, see Newcastle City Hall (Australia). Not to be confused with Newcastle Civic Centre. O2 City Hall NewcastleExterior of venue (c.2018)Former namesNewcastle City Hall (1927-2019)AddressNorthumberland RoadNewcastle upon Tyne NE1 8SF EnglandCoordinates54°58′39″N 1°36′37″W / 54.9774°N 1.6102°W / 54.9774; -1.6102OperatorAcademy Music GroupTypeConcert hallCapacity2,135Opened...

Indian dynasty (c. 225 – c.340) For other uses, see Ikshvaku (disambiguation). Ikshvakus of VijayapuriEarly 3rd century–early 4th centurySouth Asia350 CEYAUDHEYASARJUNAYANASMADRAKASMALAVASIKSHVAKUSKALABHRASWESTERNGANGASTOCHARIANSKADAMBASPALLAVASLITTLEKUSHANSLICCHAVISWESTERNSATRAPSSASANIANHINDMAHAMEGHA-VAHANASKAMARUPAGAUDASAMATATASDAVAKAKIDARITESABHIRASVAKATAKASGUPTAEMPIREKUSHANO-SASANIANSSAKASTANTURANMAKRANSASANIANEMPIRE  ◁ ▷ Location of the Andhra Ikshvakus in c. 350 CECapitalVi...

Electric commercial vehicle marque by General Motors BrightDropTypeSubsidiaryIndustry Automotive Technology FoundedJanuary 12, 2021; 2 years ago (2021-01-12)Key peopleTravis Katz (President and CEO, January 2021 – November 2023)ProductsBrightDrop ZevoParentGeneral MotorsWebsitegobrightdrop.com BrightDrop is a subsidiary[1] business created by the American manufacturer General Motors in 2021.[2] The business offers a system of connected products targeting fi...

Museum in Washington, D.C., United States Smithsonian American Art MuseumThe Lincoln Gallery at the Smithsonian American Art Museum with Electronic Superhighway: Continental U.S., Alaska, Hawaii by Nam June Paik in the backgroundInteractive fullscreen mapEstablished1829[1]Location8th and F Streets NW, Washington, D.C.[2]Coordinates38°53′52″N 77°1′24″W / 38.89778°N 77.02333°W / 38.89778; -77.02333TypeArt museumVisitors1.1 million (2022) [...

Marathi-language TV series Lavangi MirchiGenreDramaStarringSee belowCountry of originIndiaOriginal languageMarathiNo. of episodes135ProductionProduction locationsMumbai, Maharashtra, IndiaCamera setupMulti-cameraRunning time22 minutesProduction companyRuchi FilmsOriginal releaseNetworkZee MarathiRelease13 February (2023-02-13) –5 August 2023 (2023-08-05)RelatedRadhamma Kuthuru Lavangi Mirchi (transl. Chili Pepper) is an Indian Marathi language drama series which is airi...

Colombian singer (born 1977) For other uses, see Shakira (disambiguation). In this Spanish name, the first or paternal surname is Mebarak and the second or maternal family name is Ripoll. ShakiraShakira for Vogue in 2021BornShakira Isabel Mebarak Ripoll (1977-02-02) 2 February 1977 (age 46)Barranquilla, ColombiaOccupationsSingersongwriterrecord producerdanceractressphilanthropistYears active1990–presentOrganizationBarefoot FoundationWorksDiscographysongs recordedvideograph...

American scientist; grand prize winner at the 2011 Google Science Fair Shree BoseBose in 2011 (Google Science Fair winner)Born (1994-03-27) March 27, 1994 (age 29)Santa Rosa, California, U.S.Alma materHarvard College (B.A., 2016) Duke University (MD–PhD, 2023)Awards2011  Google Science Fair Grand PrizeScientific careerFieldsCancer research Websiteshreebose.com Shree Bose (born March 27, 1994) is an American scientist, inventor, and speaker. She is known as the grand priz...