Share to: share facebook share twitter share wa share telegram print page
Available for Advertising

MRPS15

MRPS15
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MRPS15, MPR-S15, RPMS15, S15mt, DC37, mitochondrial ribosomal protein S15
Зовнішні ІД OMIM: 611979 MGI: 1913657 HomoloGene: 32636 GeneCards: MRPS15
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_031280
NM_025544
RefSeq (білок)
NP_112570
NP_079820
Локус (UCSC) Хр. 1: 36.46 – 36.46 Mb Хр. 4: 125.94 – 125.95 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MRPS15 (англ. Mitochondrial ribosomal protein S15) – білок, який кодується однойменним геном, розташованим у людей на 1-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 257 амінокислот, а молекулярна маса — 29 842[4].

Послідовність амінокислот
1020304050
MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAA
RGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANK
KEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDK
AHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAH
RRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIP
KTLKDSQ

Кодований геном білок за функціями належить до рибонуклеопротеїнів, рибосомних білків. Локалізований у мітохондрії.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Koc E.C., Burkhart W., Blackburn K., Moseley A., Spremulli L.L. (2001). The small subunit of the mammalian mitochondrial ribosome: identification of the full complement of ribosomal proteins present. J. Biol. Chem. 276: 19363—19374. PMID 11279123 DOI:10.1074/jbc.M100727200
  • Amunts A., Brown A., Toots J., Scheres S.H., Ramakrishnan V. (2015). Ribosome. The structure of the human mitochondrial ribosome. Science. 348: 95—98. PMID 25838379 DOI:10.1126/science.aaa1193

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:14504 (англ.) . Архів оригіналу за 15 вересня 2015. Процитовано 18 вересня 2017.
  4. UniProt, P82914 (англ.) . Архів оригіналу за 7 серпня 2017. Процитовано 18 вересня 2017.

Див. також

Read other articles:

1955 film by T. R. Ramanna GulebakavaliTheatrical release posterDirected byT. R. RamannaScreenplay byThanjai N. Ramaiah DassProduced byT. R. RamannaStarringM. G. RamachandranT. R. RajakumariRajasulochanaG. VaralakshmiCinematographyT. K. RajabahatharEdited byM. S. ManiA. ThangarajMusic byViswanathan–RamamoorthyProductioncompanyR. R. PicturesDistributed byK. S. PicturesRelease date 29 July 1955 (1955-07-29) Running time165 minutesCountryIndiaLanguageTamil Gulebakavali (/ɡʊleɪb

2001 greatest hits album by ThalíaThalía con banda: Grandes éxitosGreatest hits album by ThalíaReleased28 August 2001RecordedVariousGenreLatin popBandaLength56:00LabelEMI LatinThalía chronology Arrasando(2000) Thalía con banda: Grandes éxitos(2001) Thalía(2002) Singles from Thalía con banda: Grandes éxitos Arrasando (Banda Version) Amor A La Mexicana (Banda Version) Piel Morena (Banda Version) La Revancha Thalía con banda: Grandes éxitos is a 2001 compilation album by Thal...

Keuskupan Agung Porto AlegreArchidioecesis Portalegrensis in BrasiliaKatolik Katedral Maria, Bunda Allah, Porto AlegreLokasiNegaraBrazilWilayahGravataí, Glorinha, Alvorada, Cachoeirinha, Viamão, Guaíba, Arambaré, Arroio dos Ratos, Barão do Triunfo, Barra do Ribeiro, Butiá, Camaquã, Cerro Grande do Sul, Charqueadas, Chuvisca, Cristal, Eldorado do Sul, General Câmara, Mariana Pimentel, Minas do Leão, São Jerônimo, Sentinela do Sul, Sertão Santana e Tapes, Canoas, Esteio, Sapuca...

Parc devant le Capitole de l'État du Colorado, espace public. Rue d'Amsterdam (Pays-Bas). Place à Hong Kong. L'espace public représente dans les sociétés humaines, en particulier urbaines, l'ensemble des espaces de passage et de rassemblement qui sont à l'usage de tous. Ils appartiennent soit à l'État (domaine public), soit à une entité juridique et morale de droit ou, exceptionnellement, au domaine privé. La définition juridique ou partagée de l'espace public a beaucoup évolué...

Về những tàu chiến Pháp khác mang cùng tên, xin xem Sénégalais (tàu chiến Pháp). Về những tàu chiến Hoa Kỳ khác mang cùng tên, xin xem USS Corbesier. Tàu hộ tống khu trục Senegalais (T-22) Lịch sử Hoa Kỳ Tên gọi USS CorbesierĐặt tên theo Antoine Joseph CorbesierXưởng đóng tàu Dravo Corporation, Wilmington, DelawareĐặt lườn 24 tháng 4, 1943Hạ thủy 11 tháng 11, 1943Xóa đăng bạ 14 tháng 5, 1952Số phận Chuyển cho Hải...

Gads ForlagTypePrivateIndustryPublishingFounded1855FounderGottlieb Ernst Clausen GadHeadquartersCopenhagen, DenmarkKey peopleJoachim Malling (Chairman), Ulrik Hvilshøj (CEO)Website[1] Gads Forlag, formerly G. E. C. Gad, is a publishing agent in Denmark. It is owned by G.E.C. Gads Fond, a publishing house based in Copenhagen, Denmark. History Gad's book shop in c. 1860 Gottlieb Ernst Clausen Gad The company was founded as G. E. C. Gad on 31 October 1855 when Gottlieb Ernst Clausen Gad establi...

Psychological pairing of characters in The Lord of the Rings Character pairing in The Lord of the Rings is a literary device used by J. R. R. Tolkien, a Roman Catholic, to express some of the moral complexity of his major characters in his heroic romance, The Lord of the Rings. Commentators have noted that the format of a fantasy does not lend itself to subtlety of characterisation, but that pairing allows inner tensions to be expressed as linked opposites, including, in a psychoanalytic inte...

Australian rules footballer Australian rules footballer Justine Mules Mules playing for Port Adelaide in September 2022Personal informationDate of birth (1994-12-15) 15 December 1994 (age 28)Original team(s) Morphettville Park (SAWFL)Draft No. 133, 2016 AFL Women's draftDebut Round 1, 2017, Adelaide vs. Greater Western Sydney, at Thebarton OvalHeight 162 cm (5 ft 4 in)Position(s) MidfielderClub informationCurrent club Port AdelaideNumber 14Playing career1Years Cl...

2007 single by Brian McFadden Like Only a Woman CanAustralian artworkSingle by Brian McFaddenfrom the album Set in Stone B-side Mud in Your Eye Inside Out Released20 April 2007 (2007-04-20)Length3:38LabelBMFSongwriter(s) Brian McFadden Phil Thornalley Producer(s)Phil ThornalleyBrian McFadden singles chronology Everybody's Someone (2006) Like Only a Woman Can (2007) Twisted (2008) Music videoLike Only a Woman Can on YouTube Like Only a Woman Can is a song written by Irish singer...

هذه المقالة تحتاج للمزيد من الوصلات للمقالات الأخرى للمساعدة في ترابط مقالات الموسوعة. فضلًا ساعد في تحسين هذه المقالة بإضافة وصلات إلى المقالات المتعلقة بها الموجودة في النص الحالي. (أبريل 2023) قالب:صندوق معلومات صيني我的父亲。 习近平:我又病又累,在重症监护室,手里有营养品免水,我们...

United States historic placePictograph CaveU.S. National Register of Historic PlacesU.S. National Historic Landmark Pictograph CaveLocation in MontanaLocationYellowstone County, Montana, United StatesNearest cityBillings, MontanaCoordinates45°44′15″N 108°25′53″W / 45.7374524°N 108.4315219°W / 45.7374524; -108.4315219[1]NRHP reference No.66000439Significant datesAdded to NRHPOctober 15, 1966Designated NHLJuly 19, 1964[2] Pictog...

Sultan Sallehuddin ShahSultan SelangorBerkuasa1742 - 1778Penobatan1756Raja MudaIbrahim ShahKelahiran1705Kematian1778Nama lengkapAlmarhum Sultan Sallehuddin Shah ibni Almarhum Daeng ChelakAyahAlmarhum Daeng ChelakIbu—AnakRaja Ibrahim Shah Raja Muda Nala Raja Punuh Raja Sharifah Raja Lumu (Sultan Sallehuddin Shah ibni Almarhum Daeng Chelak; 1705–1778) adalah Sultan Selangor yang pertama. Ia merupakan putra dari pangeran pejuang asal Bugis yang terkenal Daeng Chelak. Ia mengambil gelar Sulta...

1965 Egyptian film Dawn of a New DayEgyptian Arabicفجر يوم جديد Directed byYoussef ChahineWritten bySamir NasriAbd al-Rahman SharqawiiProduced byMary QueenyStarringSanaa GamilCinematographyAbdelaziz FahmyEdited byRachida AbdesalamMusic byAngelo Francesco LavagninoRelease date 10 February 1965 (1965-02-10) (Egypt) Running time128 minutesCountryEgyptLanguageEgyptian Arabic Dawn of a New Day (Egyptian Arabic: فجر يوم جديد, Fagr Yom gedid) is a 1965 Egyptian...

Augustus Warren GouldBornJanuary 15, 1871Amherst, Nova Scotia, CanadaDiedOctober 15, 1922 (1922-10-16) (aged 51)Tacoma, Washington, U.S.EducationMassachusetts Institute of TechnologyOccupationArchitect Empire and American Bank building Arctic Building in Seattle One of the terra cotta walruses adorning the Arctic Building. There was also a polar bear Augustus Warren Gould (January 15, 1871 – October 15, 1922[1]) was an architect in Boston and Seattle, as well as surroundin...

Bangladeshi actor and radio personality Md. Shahadat HossainHossain presenting a cultural program in 2021Born (1976-11-09) 9 November 1976 (age 47)Barisal, BangladeshNationalityBangladeshiOccupation(s)Actor, radio personality Md. Shahadat Hossain (born 9 November 1976)[1] is a Bangladeshi actor and radio personality who acted in stage, television and films. He won National Film Award 2017 in Best Supporting Actor category for Gohin Baluchor.[2][3][4] Early...

2016 Indian filmMukunda MurariTheatrical release posterDirected byNanda KishoreStory byUmesh ShuklaBased onOMG – Oh My God! Kanji Virrudh KanjiProduced byM.N.Kumar JayashreedeviStarringUpendraSudeepaIshita VyasNikita ThukralP. Ravi ShankarCinematographySudhakar S. RajEdited byK. M. PrakashMusic byArjun JanyaProductioncompaniesMNK MoviesKichcha Creations Jayashreedevi ProductionsRelease date 28 October 2016 (2016-10-28) CountryIndiaLanguageKannada Mukunda Murari is a 2016 Indi...

Noor Abu Dhabi Solar Power Plant Noor Abu Dhabi Solar Power PlantCountryUnited Arab EmiratesCoordinates24°32′33″N 55°26′38″E / 24.54250°N 55.44389°E / 24.54250; 55.44389StatusOperationalCommission date2019; 4 years ago (2019)Construction cost$870 millionOwner(s)Sweihan PV Power CompanyPower generationNameplate capacity1.117 GWExternal linksCommonsRelated media on Commons[edit on Wikidata] The Noo...

Baseball stadium in Boston, Massachusetts Fenway redirects here. For other uses, see Fenway (disambiguation). Fenway ParkAmerica's Most Beloved Ballpark[1]Friendly FenwayThe Cathedral of BaseballFenway Park in 2013Address4 Jersey Street[2]United StatesLocationBoston, Massachusetts, U.S.Coordinates42°20′46.5″N 71°5′51.9″W / 42.346250°N 71.097750°W / 42.346250; -71.097750Public transit  Framingham/Worcester Line at Lansdowne  Gr...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Chajian Waterfall – news · newspapers · books · scholar · JSTOR (November 2019) (Learn how and when to remove this template message) Waterfall in Khyber Pakhtunkhwa, PakistanChajian WaterfallA view of Chajian WaterfallShow map of Khyber PakhtunkhwaShow map of P...

Hyman George RickoverRickover pictured in 1955 as two-star rear admiral)Nama lahirChaim Godalia RickoverJulukanFather of the Nuclear NavyLahirJanuary 27, 1900 (1900-01-27)Maków Mazowiecki, PolandMeninggalJuly 8, 1986 (1986-07-09) (aged 86)Arlington County, Virginia, U.S.Pengabdian United States of AmericaDinas/cabang United States NavyLama dinas1918–1982Pangkat AdmiralKomandanUSS FinchNaval ReactorsPerang/pertempuranWorld War IICold WarPenghargaanNavy Distinguished...

Kembali kehalaman sebelumnya