EIF3K

EIF3K
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи EIF3K, EIF3-p28, EIF3S12, HSPC029, M9, MSTP001, PLAC-24, PLAC24, PRO1474, PTD001, ARG134, eukaryotic translation initiation factor 3 subunit K
Зовнішні ІД OMIM: 609596 MGI: 1921080 HomoloGene: 8292 GeneCards: EIF3K
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001300992
NM_001308393
NM_013234
NM_001285942
NM_001285943
NM_028659
RefSeq (білок)
NP_001287921
NP_001295322
NP_037366
NP_001272871
NP_001272872
NP_082935
Локус (UCSC) Хр. 19: 38.62 – 38.64 Mb Хр. 7: 28.67 – 28.68 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

EIF3K (англ. Eukaryotic translation initiation factor 3 subunit K) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 218 амінокислот, а молекулярна маса — 25 060[4].

Послідовність амінокислот
1020304050
MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAV
LKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIR
QILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITY
QHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKN
IVEKIDFDSVSSIMASSQ

Кодований геном білок за функціями належить до факторів ініціації, фосфопротеїнів. Задіяний у таких біологічних процесах, як біосинтез білків, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.

Література

  • Mayeur G.L., Fraser C.S., Peiretti F., Block K.L., Hershey J.W.B. (2003). Characterization of eIF3k: a newly discovered subunit of mammalian translation initiation factor eIF3. Eur. J. Biochem. 270: 4133—4139. PMID 14519125 DOI:10.1046/j.1432-1033.2003.03807.x
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Kolupaeva V.G., Unbehaun A., Lomakin I.B., Hellen C.U.T., Pestova T.V. (2005). Binding of eukaryotic initiation factor 3 to ribosomal 40S subunits and its role in ribosomal dissociation and anti-association. RNA. 11: 470—486. PMID 15703437 DOI:10.1261/rna.7215305
  • Masutani M., Sonenberg N., Yokoyama S., Imataka H. (2007). Reconstitution reveals the functional core of mammalian eIF3. EMBO J. 26: 3373—3383. PMID 17581632 DOI:10.1038/sj.emboj.7601765
  • Lee A.S., Kranzusch P.J., Cate J.H. (2015). eIF3 targets cell-proliferation messenger RNAs for translational activation or repression. Nature. 522: 111—114. PMID 25849773 DOI:10.1038/nature14267
  • Lee A.S., Kranzusch P.J., Doudna J.A., Cate J.H. (2016). eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation. Nature. 536: 96—99. PMID 27462815 DOI:10.1038/nature18954

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:24656 (англ.) . Архів оригіналу за 10 вересня 2015. Процитовано 12 вересня 2017. [Архівовано 2015-09-10 у Wayback Machine.]
  4. UniProt, Q9UBQ5 (англ.) . Архів оригіналу за 12 грудня 2017. Процитовано 12 вересня 2017.

Див. також


Read other articles:

Bagian dari seriIlmu Pengetahuan Formal Logika Matematika Logika matematika Statistika matematika Ilmu komputer teoretis Teori permainan Teori keputusan Ilmu aktuaria Teori informasi Teori sistem FisikalFisika Fisika klasik Fisika modern Fisika terapan Fisika komputasi Fisika atom Fisika nuklir Fisika partikel Fisika eksperimental Fisika teori Fisika benda terkondensasi Mekanika Mekanika klasik Mekanika kuantum Mekanika kontinuum Rheologi Mekanika benda padat Mekanika fluida Fisika plasma Ter...

 

Saher El NessaaSutradara Fatin Abdel Wahab ProduserDitulis olehNaguib MahfouzAbbas KamelMohamed SobhiPemeranFarid ShawkiHind RostomTewfik El DeknSoheir El-BablyWidad HamdiReyad El KasabgyKhayria AhmedFarida FahmyHassan HamedTanggal rilis1958Negara MesirBahasa Arab Saher El Nessaa (Arab: ساحر النساء) adalah sebuah film drama asal Mesir buatan tahun 1958 dan disutradarai oleh Fatin Abdel Wahab. Film ini dikenal untuk pemeran-pemerannya yang merupakan aktor-aktor bintang Mesir: Far...

 

Der Titel dieses Artikels ist mehrdeutig. Zu dem deutschen Stummfilm von 1929 siehe Wenn der weiße Flieder wieder blüht (1929). Film Titel Wenn der weiße Flieder wieder blüht Produktionsland Bundesrepublik Deutschland Originalsprache Deutsch Erscheinungsjahr 1953 Länge 98 Minuten Altersfreigabe FSK 12 Stab Regie Hans Deppe Drehbuch Eberhard Keindorff,Johanna Sibelius Produktion Kurt Ulrich(Berolina Produktion) Musik Franz Doelle Kamera Kurt Schulz Schnitt Walter Wischniewsky Besetzu...

Муктар Діакабі Особисті дані Народження 19 грудня 1996(1996-12-19)[1] (26 років)   Вандом Зріст 192 см Вага 74 кг Громадянство  Гвінея Позиція захисник Інформація про клуб Поточний клуб «Валенсія» Номер 12 Юнацькі клуби 2004—20092009–20102010–20132013–2016 «Верту» «Нант» «Верту» «Л

 

Anak Agung Gde Agung BharataBupati Gianyar ke-9Masa jabatan20 Februari 2013 – 20 Februari 2018PresidenSusilo Bambang YudhoyonoJoko WidodoGubernurMade Mangku PastikaWakilI Made MahayastraPendahuluCokorda Oka Artha Ardana SukawatiPenggantiI Made MahayastraMasa jabatan2003–2008PresidenMegawati SoekarnoputriSusilo Bambang YudhoyonoGubernurDewa Made BerathaWakilI Dewa Putu WardhanaPendahuluCokorda Gde Budi SuryawanPenggantiCokorda Oka Artha Ardana Sukawati Informasi pribadiLahir23...

 

Pond'sJenis produkKecantikanPemilikUnileverNegaraAmerika SerikatDiluncurkan1846; 176 tahun lalu (1846)PasarSeluruh duniaSitus webwww.ponds.com Pariwara cetak Pond's untuk Vanishing Cream, 1910 Pond's adalah merek produk perawatan kecantikan dan kesehatan Amerika Serikat, yang saat ini dimiliki oleh Unilever. Sejarah Pond's Cream ditemukan di Amerika Serikat sebagai obat paten oleh apoteker Theron T. Pond (1800–1852) dari Utica, New York, pada tahun 1846. Tuan Pond mengekstrak teh penye...

German historian (1778–1847) Heinrich Luden. Heinrich Luden. Heinrich Luden (10 April 1778 – 23 May 1847) was a German historian. Luden was born in Loxstedt in the district of Stade. At the age of 17 Luden went to the Domschule (Cathedral School) in Bremen. He subsequently studied theology at the University of Göttingen, where he came under the influence of the historians August Ludwig von Schlözer and later Johannes von Müller and devoted himself to the study of history. He was br...

 

Australian ballroom dancer This article may have too many section headers. Please help consolidate the article. (January 2022) (Learn how and when to remove this template message) This biography of a living person needs additional citations for verification. Please help by adding reliable sources. Contentious material about living persons that is unsourced or poorly sourced must be removed immediately from the article and its talk page, especially if potentially libelous.Find sources: Sh...

 

У Вікіпедії є статті про інших людей із прізвищем Єнсен. |Ім?я= |Опис= |розмір_зображення= Ганс ЄнсенJohannes Hans Daniel Jensen Ім'я при народженні англ. Hans Daniel JensenНародився 25 червня 1907(1907-06-25)Гамбург, Німецька імперіяПомер 11 лютого 1973(1973-02-11) (65 років)Гейдельберг, НімеччинаКраїна  ФРН&#...

Ethnic group of Indonesia Muna peopleWuna peopleResidents of the Muna Island, Southeast Sulawesi, Indonesia.Total population321,000[1]Regions with significant populations Indonesia:Southeast Sulawesi (Buton & Muna Island)Maluku Islands  Malaysia:Sabah (Kota Kinabalu & Tawau)LanguagesMuna–Buton languages (Busoa language, Kaimbulawa language, Liabuku language, Muna language, Pancana language, Kioko language), Indonesian languageReligionIslam (predominantly)Related et...

 

Kepala Staf TNI Angkatan DaratLambang TNI Angkatan DaratBendera pangkat JenderalPetahanaJenderal TNI Maruli Simanjuntaksejak 29 November 2023Tentara Nasional Indonesia Angkatan DaratSingkatanKASAD atau KSADAtasanPanglima Tentara Nasional IndonesiaKantorJakartaDicalonkan olehPanglima Tentara Nasional IndonesiaDitunjuk olehPresiden IndonesiaDasar hukumPenetapan Presiden No. 14 Tahun 1948Dibentuk15 Mei 1948; 75 tahun lalu (1948-05-15)Pejabat pertamaDjatikoesoemoWakilLetnan Jenderal TNI...

 

American basketball player Pam KellyPersonal informationBornColumbia, Louisiana, U.S.NationalityAmericanListed height6 ft 0 in (1.83 m)Career informationCollegeLouisiana TechPlaying career1978–1982PositionCenterCareer highlights and awards Wade Trophy (1982) 3× Kodak All-American (1980-1982) Broderick Award (1982) Louisiana Tech Athletic Hall of Fame (1984) Women's Basketball Hall of Fame Pamela Kelly-Flowers, a native of Columbia, Louisiana[1] is a former American w...

Ada usul agar Low Back Pain / Lumbago digabungkan ke artikel ini. (Diskusikan) Diusulkan sejak Desember 2016. artikel ini perlu dirapikan agar memenuhi standar Wikipedia. Tidak ada alasan yang diberikan. Silakan kembangkan artikel ini semampu Anda. Merapikan artikel dapat dilakukan dengan wikifikasi atau membagi artikel ke paragraf-paragraf. Jika sudah dirapikan, silakan hapus templat ini. (Pelajari cara dan kapan saatnya untuk menghapus pesan templat ini) Nyeri punggungBagian-bagian dari tul...

 

Інокентій (Зельницький) Архієпископ Інокентій (Зельницький) Архієпископ Тамбовський і Мічурінський 16 листопада 1962 — 10 березня 1968 Церква: Російська православна церква Попередник: Михаіл (Чуб) Наступник: Пимен (Ізвєков) Архієпископ Архангельський і Холмогорський 16 б...

 

Series of video games This article is about the video game series. For the first installment, see The Sims (video game). For other uses, see Sims. Video game seriesThe SimsThe Sims series logo (2014–present)Genre(s)Life simulation, Social simulationDeveloper(s)MaxisPublisher(s)Electronic ArtsCreator(s)Will WrightPlatform(s)Microsoft Windows, Mac OS, PlayStation 2, GameCube, Xbox, Game Boy Advance, Nintendo DS, PlayStation Portable, Java ME, BlackBerry OS, Bada, PlayStation 3, Xbox 360, Wii,...

1976 American comedy film by Charles Bail Gumball Rally redirects here. For other uses, see Gumball Rally (disambiguation). The Gumball RallyTheatrical release posterDirected byCharles BailScreenplay byLeon CapetanosStory byLeon CapetanosCharles BailProduced byCharles BailStarringMichael SarrazinNorman BurtonRaúl JuliáGary BuseyCinematographyRichard C. GlounerEdited byStuart H. PappeGordon ScottMaury WinetrobeMusic byDominic FrontiereProductioncompanyFirst ArtistsDistributed byWarner Bros.R...

 

2017 soundtrack album by A. R. Rahman This article may have been created or edited in return for undisclosed payments, a violation of Wikipedia's terms of use. It may require cleanup to comply with Wikipedia's content policies, particularly neutral point of view. (July 2021) MersalSoundtrack album by A. R. RahmanReleased20 August 2017 (2017-08-20)Recorded2017StudioPanchathan Record Inn and AM Studios,  ChennaiA. R. Studios, MumbaiAbbey Road Studios, LondonGenreFeature ...

 

Major Arcanum The Fool from the Rider–Waite tarot deck The Fool is one of the 78 cards in a tarot deck. In tarot card reading, it is one of the 22 Major Arcana, sometimes numbered as 0 (the first) or XXII (the last). However, in decks designed for playing traditional tarot card games, it is typically unnumbered, as it is not one of the 21 trump cards and instead serves a unique purpose by itself. Iconography A standard medieval allegory of Foolishness, painted by Giotto from Scrovegni Chape...

This FIR transfer function may need to be rewritten to comply with Wikipedia's quality standards, as it is written like a tutorial. You can help. The talk page may contain suggestions. (December 2020)Transfer function filter utilizes the transfer function and the Convolution theorem to produce a filter. In this article, an example of such a filter using finite impulse response is discussed and an application of the filter into real world data is shown. FIR (Finite Impulse Response) Linear fil...

 

El texto que sigue es una traducción defectuosa. Si quieres colaborar con Wikipedia, busca el artículo original y mejora esta traducción.Copia y pega el siguiente código en la página de discusión del autor de este artículo: {{subst:Aviso mal traducido|Sitar eléctrico}} ~~~~ Este artículo o sección necesita una revisión de ortografía y gramática.Puedes colaborar editándolo. Cuando se haya corregido, puedes borrar este aviso. Si has iniciado sesión, puedes ayudarte del corrector ...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!