Share to: share facebook share twitter share wa share telegram print page

NAGA

NAGA
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NAGA, D22S674, GALB, alpha-N-acetylgalactosaminidase
Зовнішні ІД OMIM: 104170 MGI: 1261422 HomoloGene: 221 GeneCards: NAGA
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000262
NM_001362848
NM_001362850
NM_008669
NM_001355546
RefSeq (білок)
NP_000253
NP_001349777
NP_001349779
NP_000253.1
NP_032695
NP_001342475
Локус (UCSC) Хр. 22: 42.06 – 42.07 Mb Хр. 15: 82.21 – 82.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NAGA (англ. Alpha-N-acetylgalactosaminidase) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 411 амінокислот, а молекулярна маса — 46 565[4].

Послідовність амінокислот
1020304050
MLLKTVLLLGHVAQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCI
SEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPH
GIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKV
DMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRV
NYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWND
PDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNP
LMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYR
YHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYL
YPIKNLEMSQQ

Кодований геном білок за функціями належить до гідролаз, глікозидаз, фосфопротеїнів. Локалізований у лізосомі.

Література

  • Wang A.M., Desnick R.J. (1991). Structural organization and complete sequence of the human alpha-N-acetylgalactosaminidase gene: homology with the alpha-galactosidase A gene provides evidence for evolution from a common ancestral gene. Genomics. 10: 133—142. PMID 1646157 DOI:10.1016/0888-7543(91)90493-X
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Warner T.G., Louie A., Potier M. (1990). Photolabeling of the alpha-neuraminidase/beta-galactosidase complex from human placenta with a photoreactive neuraminidase inhibitor. Biochem. Biophys. Res. Commun. 173: 13—19. PMID 2256909 DOI:10.1016/S0006-291X(05)81014-9
  • Clark N.E., Garman S.C. (2009). The 1.9 A structure of human alpha-N-acetylgalactosaminidase: the molecular basis of Schindler and Kanzaki diseases. J. Mol. Biol. 393: 435—447. PMID 19683538 DOI:10.1016/j.jmb.2009.08.021
  • Wang A.M., Schindler D., Desnick R.J. (1990). Schindler disease: the molecular lesion in the alpha-N-acetylgalactosaminidase gene that causes an infantile neuroaxonal dystrophy. J. Clin. Invest. 86: 1752—1756. PMID 2243144 DOI:10.1172/JCI114901
  • Wang A.M., Kanzaki T., Desnick R.J. (1994). The molecular lesion in the alpha-N-acetylgalactosaminidase gene that causes angiokeratoma corporis diffusum with glycopeptiduria. J. Clin. Invest. 94: 839—845. PMID 8040340 DOI:10.1172/JCI117404

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:7631 (англ.) . Архів оригіналу за 12 червня 2017. Процитовано 12 вересня 2017.
  4. UniProt, P17050 (англ.) . Архів оригіналу за 3 серпня 2017. Процитовано 12 вересня 2017.

Див. також

Read other articles:

مسعود کیمیایی معلومات شخصية اسم الولادة مسعود کیمیایی الميلاد 29 يوليو 1941 (العمر 82 سنة)طهران, إيران الجنسية إيراني الزوجة كوكوش (1991–2003)غيتي باشائي (1969–1991)  الحياة العملية المدرسة الأم جامعة كاليفورنيا  المهنة مخرجكاتب السيناريو اللغات الفارسية  سنوات النشاط 1968-إلى ا

Ева-Марія Шюргофф Eva-Maria SchürhoffГромадянство  НімеччинаДата народження 8 грудня 1969Місце народження Бергнойштадт, Західна НімеччинаПризові, USD $30,121Одиночний розрядТитулів 5 ITFНайвища позиція Ранг 235 (31 липня 1989)Турніри Великого шлемаАвстралія 1р (1990)Парний розрядТитулів 5 ITF

Kochłowy ? Hilfe zu Wappen Kochłowy (Polen) Basisdaten Staat: Polen Woiwodschaft: Großpolen Powiat: Ostrzeszowski Gmina: Ostrzeszów Geographische Lage: 51° 22′ N, 17° 57′ O51.36027777777817.957222222222Koordinaten: 51° 21′ 37″ N, 17° 57′ 26″ O Einwohner: 314 (2022) Postleitzahl: 63-500 Telefonvorwahl: (+48) 62 Kfz-Kennzeichen: POT Kochłowy (deutsch Kochlow) ist eine Ortschaft mit einem Schulzenamt der Landgemeinde Ostrzeszów…

Species of mammal L'Hoest's monkey[1] At the Bwindi Impenetrable Forest, Uganda Conservation status Vulnerable (IUCN 3.1)[2] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Mammalia Order: Primates Suborder: Haplorhini Infraorder: Simiiformes Family: Cercopithecidae Genus: Allochrocebus Species: A. lhoesti Binomial name Allochrocebus lhoestiP. Sclater, 1899 Geographic distribution feeding, Bwindi Impenetrable Forest, Uganda Colchest…

Bridge over the Rhine This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Theodor Heuss Bridge Düsseldorf – news · newspapers · books · scholar · JSTOR (June 2021) (Learn how and when to remove this template message) Theodor Heuss BridgeThe Theodor Heuss Bridge in DüsseldorfCoordinates51°14′49″N 6°45

Ця стаття містить текст, що не відповідає енциклопедичному стилю. Будь ласка, допоможіть удосконалити цю статтю, погодивши стиль викладу зі стилістичними правилами Вікіпедії. Можливо, сторінка обговорення містить зауваження щодо потрібних змін. (серпень 2018) Володимир Ю…

شريان معدي ثربي أيمن الاسم العلميarteria gastro-omentalis dextra, arteria gastroepiploica dextra The celiac artery and its branches; the liver has been raised, and the lesser omentum and anterior layer of the greater omentum removed. (Right gastroepiploic artery visible at lower left.) Right and left gastroomental is at #4.Right and left gastroomental is at #4. تفاصيل الوريد المرافق وريد معدي ثربي أيمن يتفرع من شريان مع…

Corpo delle infermiere volontarie della Croce Rossa ItalianaDistintivo del Corpo II.VV.-C.R.I. Descrizione generaleAttiva1908 – oggi Nazione Regno d'Italia Repubblica Sociale Italiana Italia ServizioForze armate italiane TipoCorpo ausiliario RuoloPrimo soccorso in zone di guerra/operazioni umanitarie multinazionali, protezione civile Dimensione10 124 unità (2008) SoprannomeCrocerossine PatronoSanta Caterina da Siena MottoAma, Conforta, Lavora, Salva ColoriBianco Battaglie/guerr…

The Animal That Therefore I Am Cover of the first English-language editionAuthorJacques DerridaOriginal titleL'animal que donc je suisTranslatorDavid WillsCountryFranceLanguageFrenchSubjectPhilosophyPublisherÉditions Galilée, Fordham University Press (English translation)Publication date2006Published in English2008Media typePrintPages176 (English translation with translator's notes)ISBN978-0-8232-2791-4 (English-language edition) The Animal That Therefore I Am (French: L'Animal …

Rosa murielae Біологічна класифікація Царство: Рослини (Plantae) Клада: Судинні рослини (Tracheophyta) Клада: Покритонасінні (Angiosperms) Клада: Евдикоти (Eudicots) Клада: Розиди (Rosids) Порядок: Розоцвіті (Rosales) Родина: Трояндові (Rosaceae) Рід: Троянда (Rosa) Вид: R. murielae Біноміальна назва Rosa murielaeRehder & E.H.Wilso…

Kono Yūsha ga Ore Tsuē Kuse ni Shinchō SugiruSampul novel ringan volume pertamaこの勇者が俺TUEEEくせに慎重すぎる(Kono Yūsha ga Ore Tsuē Kuse ni Shinchō Sugiru)GenreKomedi fantasi, isekai[1] Seri novelPengarangLight TuchihiPenerbitKakuyomuTerbit4 Juni 2016 – sekarang Novel ringanPengarangLight TuchihiIlustratorSaori ToyotaPenerbitFujimi ShoboPenerbit bahasa InggrisNA Yen PressImprintKadokawa BooksDemografiPriaTerbit10 Februari 2017 – sekarangVolume7 MangaPengarangL…

Bzí Bzí (Dolní Bukovsko) (Tschechien) Basisdaten Staat: Tschechien Tschechien Region: Jihočeský kraj Bezirk: České Budějovice Gemeinde: Dolní Bukovsko Fläche: 650[1] ha Geographische Lage: 49° 11′ N, 14° 32′ O49.18194444444414.539444444444490Koordinaten: 49° 10′ 55″ N, 14° 32′ 22″ O Höhe: 490 m n.m. Einwohner: 49 (1. März 2001) Postleitzahl: 373 65 Kfz-Kennzeichen: C Verkehr Straße: Týn nad Vlt…

Vụ Khảo cứu Quốc hộiTổng quan Cơ quanThành lập1914Cơ quan tiền thânVụ Tham khảo Lập phápTrụ sởWashington, DCNgân quỹ hàng năm86 386 812 USD (năm 2003)Các Lãnh đạo Cơ quanDaniel P. Mulhollan, Giám đốcAngela M. Evans, Phó Giám đốcTrực thuộc cơ quanThư viện Quốc hội Hoa KỳWebsitewww.loc.gov/crsinfo/ Vụ Khảo cứu Quốc hội (Congressional Research Service) là cơ quan khảo cứu chính sách công của Quốc hội Hoa Kỳ…

American historian (1874–1948) Charles A. BeardBeard in 1917BornCharles Austin Beard(1874-11-27)November 27, 1874Knightstown, Indiana, USDiedSeptember 1, 1948(1948-09-01) (aged 73)New Haven, Connecticut, USSpouse Mary Ritter Beard ​(m. 1900)​Academic backgroundAlma materDePauw UniversityColumbia UniversityThesisThe Office of Justice of the Peace in England (1904)Academic advisorsFrederick York Powell[1]Academic workDisciplineHistorypolitical scien…

2010 soundtrack album to Raavan by A. R. Rahman RaavanSoundtrack album by A. R. RahmanReleased24 April 2010Recorded2009–2010StudioPanchathan Record Inn and A.M. Studios, ChennaiGenreFeature film soundtrackLength30:02LabelT-SeriesProducerA. R. RahmanA. R. Rahman chronology Ye Maaya Chesave(2010) Raavan(2010) Raavanan(2010) Raavan is the soundtrack composed by A. R. Rahman, who accompanied for the music and background score for the 2010 Hindi film of the same name, directed by Mani Ratnam. I…

Map of the known world dating from c.1300 The Hereford mappa mundi, a map of the world with Jerusalem at its centre The new library at Hereford Cathedral (right) where the map is now housed The Hereford Mappa Mundi is a medieval map of the known world (Latin: mappa mundi), of a form deriving from the T and O pattern, dating from c. 1300. Archeological scholars believe the map to have originated from eastern England in either Yorkshire or Lincolnshire before it was transported westward to Herefor…

Plot 20 JuliMartin Bormann, Hermann Göring, dan Bruno Loerzer mengamati ruang konferensi yang rusakWolf's LairLokasi di Prusia TimurJenisPemogokan pemenggalan kepalaLokasiWolf's Lair, Prusia Timur54°04′50″N 21°29′47″E / 54.08056°N 21.49639°E / 54.08056; 21.49639Koordinat: 54°04′50″N 21°29′47″E / 54.08056°N 21.49639°E / 54.08056; 21.49639PerencanaHenning von TresckowErwin von WitzlebenClaus von StauffenbergTujuanBunuh Adolf …

Former Politician from Tamil Nadu,India Kaduvetti GuruMember of the Legislative AssemblyIn office2001–2006Preceded byRajendiranSucceeded byS. S. SivasankarConstituencyAndimadam (state assembly constituency)In office2011–2016Preceded byK. RajendranSucceeded byJ. K. N. RamajeyalingamConstituencyJayankondam Personal detailsBornJ Gurunathan(1961-02-01)1 February 1961Kaduvetti , Jayankondam, Udayarpalayam taluk, Ariyalur district, Tamil NaduDiedMay 25, 2018(2018-05-25) (aged 57)Chennai, Tami…

Danish cyclist (born 2000) Mattias SkjelmoseSkjelmose in 2023Personal informationFull nameMattias Skjelmose JensenBorn (2000-09-26) 26 September 2000 (age 23)Copenhagen, DenmarkHeight1.80 m (5 ft 11 in)[1]Weight65 kg (143 lb)[1]Team informationCurrent teamLidl–TrekDisciplineRoadRoleRiderRider typeAll-rounder [2][3]Amateur teams2012–2016Amager Cykle Ring2017–2018Team Børkop CyklerCarl Ras Roskilde Junior2019IBT-Ri…

Murat DirekciBornMurat Direkci (1979-07-17) July 17, 1979 (age 44)Antwerp, BelgiumNationality Belgian TurkishHeight1.75 m (5 ft 9 in)Weight77 kg (170 lb; 12.1 st)DivisionMiddleweight, Super MiddleweightStyleKickboxing, Muay ThaiTeamUniversal GymKickboxing recordTotal88Wins69By knockout57Losses17By knockout4Draws2 Last updated on: September 27, 2020 Murat Direkci (born 17 July 1975[1] in Antwerp, Belgium) is a Belgian-Turkish middleweight kickb…

Kembali kehalaman sebelumnya