STX4

STX4
Identifikatori
AliasiSTX4
Vanjski ID-jeviOMIM: 186591 MGI: 893577 HomoloGene: 105435 GeneCards: STX4
Lokacija gena (čovjek)
Hromosom 16 (čovjek)
Hrom.Hromosom 16 (čovjek)[1]
Hromosom 16 (čovjek)
Genomska lokacija za STX4
Genomska lokacija za STX4
Bend16p11.2Početak31,032,889 bp[1]
Kraj31,042,975 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za STX4
Genomska lokacija za STX4
Bend7|7 F3Početak127,423,466 bp[2]
Kraj127,448,191 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija SNAP receptor activity
GO:0001948, GO:0016582 vezivanje za proteine
sphingomyelin phosphodiesterase activator activity
SNARE binding
Ćelijska komponenta citoplazma
integral component of membrane
citosol
endozom
membrana
Sinapsna vezikula
ćelijska membrana
myelin sheath adaxonal region
dendritična kičma
sinapsa
intracellular anatomical structure
cell surface
Vakuola
trans-Golđijeva mreža
basolateral plasma membrane
somatodendritic compartment
specific granule
lateral loop
perinuklearno područje citoplazme
storage vacuole
Egzosom
lamellipodium
SNARE complex
Vanćelijsko
phagocytic vesicle membrane
Endomembranski sistem
presynaptic membrane
phagocytic vesicle
presynaptic active zone membrane
postsynapse
glutamatergic synapse
Biološki proces positive regulation of eosinophil degranulation
positive regulation of cell migration
organelle fusion
synaptic vesicle fusion to presynaptic active zone membrane
response to hydroperoxide
GO:0048554 positive regulation of catalytic activity
post-Golgi vesicle-mediated transport
regulation of exocytosis
vesicle docking
positive regulation of protein localization to plasma membrane
positive regulation of chemotaxis
positive regulation of cell population proliferation
positive regulation of protein localization to cell surface
regulation of extrinsic apoptotic signaling pathway via death domain receptors
positive regulation of insulin secretion involved in cellular response to glucose stimulus
intracellular protein transport
neurotransmitter transport
vesicle-mediated transport
SNARE complex assembly
positive regulation of cell adhesion
long-term potentiation
vesicle fusion with endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membrane
GO:0015915 transport
Egzocitoza
Fuzija vezikula
cytokine-mediated signaling pathway
cellular response to interferon-gamma
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001272095
NM_001272096
NM_004604

NM_009294

RefSeq (bjelančevina)

NP_001259024
NP_001259025
NP_004595

NP_033320

Lokacija (UCSC)Chr 16: 31.03 – 31.04 MbChr 7: 127.42 – 127.45 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Sintaksin-4 jest protein koji je kod ljudi kodiran genom STX4 sa hromosoma 16.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 297 aminokiselina, a molekulska težina 34.180 Da.[5]

1020304050
MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQ
TIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQ
LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
KNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQAL
NEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSAD
YVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG

Interakcije

Pokazalo se da je STX4 u interakciji sa:

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000103496 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000030805 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b Li H, Hodge DR, Pei GK, Seth A (Jun 1994). "Isolation and sequence analysis of the human syntaxin-encoding gene". Gene. 143 (2): 303–4. doi:10.1016/0378-1119(94)90117-1. PMID 8206394.
  6. ^ Low SH, Vasanji A, Nanduri J, He M, Sharma N, Koo M, Drazba J, Weimbs T (Feb 2006). "Syntaxins 3 and 4 are concentrated in separate clusters on the plasma membrane before the establishment of cell polarity". Molecular Biology of the Cell. 17 (2): 977–89. doi:10.1091/mbc.E05-05-0462. PMC 1356605. PMID 16339081.
  7. ^ "Entrez Gene: STX4 Syntaxin 4".
  8. ^ Kalwat MA, Wiseman DA, Luo W, Wang Z, Thurmond DC (January 2012). "Gelsolin associates with the N terminus of syntaxin 4 to regulate insulin granule exocytosis". Molecular Endocrinology. Baltimore, Md. 26 (1): 128–41. doi:10.1210/me.2011-1112. PMC 3248323. PMID 22108804.
  9. ^ a b Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M (Oct 2005). "Towards a proteome-scale map of the human protein-protein interaction network". Nature. 437 (7062): 1173–8. doi:10.1038/nature04209. PMID 16189514. S2CID 4427026.
  10. ^ Li L, Omata W, Kojima I, Shibata H (Feb 2001). "Direct interaction of Rab4 with syntaxin 4". The Journal of Biological Chemistry. 276 (7): 5265–73. doi:10.1074/jbc.M003883200. PMID 11063739.
  11. ^ a b Hata Y, Südhof TC (Jun 1995). "A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic". The Journal of Biological Chemistry. 270 (22): 13022–8. doi:10.1074/jbc.270.22.13022. PMID 7768895.
  12. ^ a b Ravichandran V, Chawla A, Roche PA (Jun 1996). "Identification of a novel syntaxin- and synaptobrevin/VAMP-binding protein, SNAP-23, expressed in non-neuronal tissues". The Journal of Biological Chemistry. 271 (23): 13300–3. doi:10.1074/jbc.271.23.13300. PMID 8663154.
  13. ^ a b Reed GL, Houng AK, Fitzgerald ML (Apr 1999). "Human platelets contain SNARE proteins and a Sec1p homologue that interacts with syntaxin 4 and is phosphorylated after thrombin activation: implications for platelet secretion". Blood. 93 (8): 2617–26. doi:10.1182/blood.V93.8.2617. PMID 10194441.
  14. ^ a b Steegmaier M, Yang B, Yoo JS, Huang B, Shen M, Yu S, Luo Y, Scheller RH (Dec 1998). "Three novel proteins of the syntaxin/SNAP-25 family". The Journal of Biological Chemistry. 273 (51): 34171–9. doi:10.1074/jbc.273.51.34171. PMID 9852078.
  15. ^ a b Imai A, Nashida T, Yoshie S, Shimomura H (Aug 2003). "Intracellular localisation of SNARE proteins in rat parotid acinar cells: SNARE complexes on the apical plasma membrane". Archives of Oral Biology. 48 (8): 597–604. doi:10.1016/s0003-9969(03)00116-x. PMID 12828989.
  16. ^ Li G, Alexander EA, Schwartz JH (May 2003). "Syntaxin isoform specificity in the regulation of renal H+-ATPase exocytosis". The Journal of Biological Chemistry. 278 (22): 19791–7. doi:10.1074/jbc.M212250200. PMID 12651853.
  17. ^ Araki S, Tamori Y, Kawanishi M, Shinoda H, Masugi J, Mori H, Niki T, Okazawa H, Kubota T, Kasuga M (May 1997). "Inhibition of the binding of SNAP-23 to syntaxin 4 by Munc18c". Biochemical and Biophysical Research Communications. 234 (1): 257–62. doi:10.1006/bbrc.1997.6560. PMID 9168999.
  18. ^ a b c d Paumet F, Le Mao J, Martin S, Galli T, David B, Blank U, Roa M (Jun 2000). "Soluble NSF attachment protein receptors (SNAREs) in RBL-2H3 mast cells: functional role of syntaxin 4 in exocytosis and identification of a vesicle-associated membrane protein 8-containing secretory compartment". Journal of Immunology. 164 (11): 5850–7. doi:10.4049/jimmunol.164.11.5850. PMID 10820264.
  19. ^ Kawanishi M, Tamori Y, Okazawa H, Araki S, Shinoda H, Kasuga M (Mar 2000). "Role of SNAP23 in insulin-induced translocation of GLUT4 in 3T3-L1 adipocytes. Mediation of complex formation between syntaxin4 and VAMP2". The Journal of Biological Chemistry. 275 (11): 8240–7. doi:10.1074/jbc.275.11.8240. PMID 10713150.
  20. ^ Freedman SJ, Song HK, Xu Y, Sun ZY, Eck MJ (Apr 2003). "Homotetrameric structure of the SNAP-23 N-terminal coiled-coil domain". The Journal of Biological Chemistry. 278 (15): 13462–7. doi:10.1074/jbc.M210483200. PMID 12556468.
  21. ^ a b Schraw TD, Lemons PP, Dean WL, Whiteheart SW (Aug 2003). "A role for Sec1/Munc18 proteins in platelet exocytosis". The Biochemical Journal. 374 (Pt 1): 207–17. doi:10.1042/BJ20030610. PMC 1223584. PMID 12773094.
  22. ^ a b Widberg CH, Bryant NJ, Girotti M, Rea S, James DE (Sep 2003). "Tomosyn interacts with the t-SNAREs syntaxin4 and SNAP23 and plays a role in insulin-stimulated GLUT4 translocation". The Journal of Biological Chemistry. 278 (37): 35093–101. doi:10.1074/jbc.M304261200. PMID 12832401.
  23. ^ Nogami S, Satoh S, Tanaka-Nakadate S, Yoshida K, Nakano M, Terano A, Shirataki H (Jul 2004). "Identification and characterization of taxilin isoforms". Biochemical and Biophysical Research Communications. 319 (3): 936–43. doi:10.1016/j.bbrc.2004.05.073. PMID 15184072.
  24. ^ Mollinedo F, Martín-Martín B, Calafat J, Nabokina SM, Lazo PA (Jan 2003). "Role of vesicle-associated membrane protein-2, through Q-soluble N-ethylmaleimide-sensitive factor attachment protein receptor/R-soluble N-ethylmaleimide-sensitive factor attachment protein receptor interaction, in the exocytosis of specific and tertiary granules of human neutrophils". Journal of Immunology. 170 (2): 1034–42. doi:10.4049/jimmunol.170.2.1034. PMID 12517971.
  25. ^ Jagadish MN, Fernandez CS, Hewish DR, Macaulay SL, Gough KH, Grusovin J, Verkuylen A, Cosgrove L, Alafaci A, Frenkel MJ, Ward CW (Aug 1996). "Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2". The Biochemical Journal. 317 (3): 945–54. doi:10.1042/bj3170945. PMC 1217577. PMID 8760387.
  26. ^ a b Polgár J, Chung SH, Reed GL (Aug 2002). "Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion". Blood. 100 (3): 1081–3. doi:10.1182/blood.v100.3.1081. PMID 12130530.

Dopunska literatura

Vanjski linkovi

Read other articles:

1959 filmHare-abian NightsDirected byKen HarrisStory byMichael MalteseProduced byJohn Burton (uncredited)StarringMel BlancMusic byMilt FranklynAnimation byKen HarrisBen WashamLayouts bySamuel ArmstrongBackgrounds byPhilip DeGuardColor processTechnicolorProductioncompanyWarner Bros. CartoonsDistributed byWarner Bros. PicturesThe Vitaphone CorporationRelease date February 28, 1959 (1959-02-28) Running time6 minutes 56 seconds Hare-abian Nights is a 1959 Warner Bros. Merrie Melodi...

 

This article relies excessively on references to primary sources. Please improve this article by adding secondary or tertiary sources. Find sources: Japan and the International Monetary Fund – news · newspapers · books · scholar · JSTOR (July 2022) (Learn how and when to remove this template message) Japan joined the International Monetary Fund (IMF) on August 13, 1952. Since then, Japan has sustained a stable relationship with the IMF and supported th...

 

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (يوليو 2023) حلية شبكيةتعديل - تعديل مصدري - تعديل ويكي بيانات الحلية الشبكية[1] تصميم زخرفي متشابك محفور إما بنقش منخفض على خلفية صلبة أو مقطوع باستخدام منشار حنق أو من

Voor de gelijknamige plaats in Mississippi, zie Glen (Mississippi). Glendalough Valley in Ierland. Een glen is in Schotland en Ierland de naam van een vallei, vaak uitgesleten door een gletsjer. Glens zijn dan ook vaak lang en diep en hebben een kenmerkende U-vormige doorsnede. Het woord glen stamt af van het Iers-/Schots-Gaelische woord gleann. Glen in de naam van een rivier stamt echter af van het Welshe glan, dat schoon, of gleindid, dat puurheid betekent.

 

1983 video game 1983 video gameOne on One: Dr. J vs. Larry BirdDeveloper(s)Electronic ArtsPublisher(s)Electronic ArtsEU: AriolasoftAtari Corporation (7800)[1]Designer(s)Eric HammondPlatform(s)Apple II, Amiga, Atari 7800, Atari 8-bit, ColecoVision, Commodore 64, IBM PC, Macintosh, TRS-80 Color ComputerRelease1983: Apple II1984: Atari 8-bit, C64, IBM PC1985: CoCo, Mac, Spectrum1986: Amiga1987: Atari 7800[1]Genre(s)Sports (basketball)Mode(s)Single-player, multiplayer One on One: ...

 

Amida-Buddha-Daibutsu (13. Jh.) am Kōtoku-in im japanischen Kamakura Amida-Buddha im Westlichen Paradies, dem Reinen Land (8. Jh., Tun Huang, China) Amida-Buddha am Donglin Tempel im südchinesischen Lushan Amitabha-Buddhismus ist eine Sammelbezeichnung für jene Schulen des Mahayana-Buddhismus, die sich auf den transzendenten Buddha Amitabha beziehen. Im 1./2. Jahrhundert in Indien entstanden, gelangte die Lehre ab dem 5. Jahrhundert nach China, wo sie den Namen Jingtu zong (chinesisch 

Der Titel dieses Artikels ist mehrdeutig. Weitere Bedeutungen sind unter Schnellenbach (Begriffsklärung) aufgeführt. Schnellenbach Gemeinde Engelskirchen Koordinaten: 51° 0′ N, 7° 27′ O51.0044444444447.4519444444444223Koordinaten: 51° 0′ 16″ N, 7° 27′ 7″ O Höhe: 223 m ü. NHN Einwohner: 1343 (31. Dez. 2007) Postleitzahl: 51766 Vorwahl: 02263 Schnellenbach (Engelskirchen) Lage von Schnellenbach in Eng...

 

Опис файлу Опис Логотип ФК «Сімург (футбольний клуб)» Джерело https://www.facebook.com/155075434603302/photos/a.155135754597270.29448.155075434603302/382405821870261/?type=1&theater Час створення Невідомо Автор зображення ФК «Сімург (футбольний клуб)» Ліцензія див. нижче Обґрунтування добропорядного використання для 

 

Cruz de Piedra UbicaciónCoordenadas 28°28′46″N 16°18′44″O / 28.479472222222, -16.312194444444Dirección Municipio de San Cristóbal de La LagunaBarrio NuevoSector Zona Líneas Museo de la Ciencia ← → Padre Anchieta [editar datos en Wikidata] Cruz de Piedra es el nombre de una parada de la línea 1 del Tranvía de Tenerife. Se encuentra en Barrio Nuevo, en San Cristóbal de La Laguna. Su nombre deriva de la Cruz de Piedra que se encuentra en una rotonda...

Untuk perubahan iklim global saat ini, lihat Perebusan global. Untuk istilah yang menggambarkan pemanasan global dan perubahan iklim, lihat Krisis iklim. Untuk perubahan iklim lampau, lihat paleoklimatologi dan catatan suhu geologi. Ilmu atmosfer Fisik atmosfer Dinamika atmosfer (kategori) Kimia atmosfer (kategori) Meteorologi Cuaca (kategori) · (portal) Badai tropis (kategori) Klimatologi Iklim (kategori) Perubahan iklim (kategori) Pemanasan global (kategori) · (portal) A...

 

Jimmy Somerville discography Singer performing during the 10th anniversaryof Here and Now Tour, held on 25 June 2011 at the Echo Arena in Liverpool, England. Releases:[a] Studio albums 9 Remix albums 3 Live albums 5 Compilation albums 10 EPs 4 Singles 39 Download singles 15 Promotional singles 4 Other songs 61 Video albums/EPs 5 Music videos 38 Scottish recording artist Jimmy Somerville has entered the music industry as the frontman of the synth-pop act, known as Bronski Beat. Alongsi...

 

Public space in midtown Tel Aviv Habima Square Habima Square (Hebrew: כיכר הבימה, lit. The Stage's Square, also known as The Orchestra Plaza) is a major public space in the center of Tel Aviv, Israel, which is home to a number of cultural institutions such as the Habima Theatre, the Culture Palace, and the Helena Rubinstein Pavilion for Contemporary Art. The square is at the intersection of Rothschild Boulevard, Hen Boulevard, Dizengoff Street, and Ben-Zion Boulevard. Uprise by Menas...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Merah Putih film – news · newspapers · books · scholar · JSTOR (March 2015) (Learn how and when to remove this template message) 2009 Indonesian filmMerah PutihposterDirected byYadi SugandiWritten byConor AllynRob AllynStarringDonny AlamsyahLukman SardiDar...

 

1941 American drama film directed by Julien Duvivier Lydiatheatrical posterDirected byJulien DuvivierWritten byLeslie Bush-FeketeJulien DuvivierScreenplay byBen HechtSamuel HoffensteinAndré De Toth (uncredited)Based onStory: Un Carnet de BalProduced byAlexander KordaStarringMerle OberonJoseph CottenHans JarayAlan MarshalEdna May OliverCinematographyLee GarmesEdited byWilliam HornbeckMusic byMiklós RózsaProductioncompaniesAlexander Korda FilmsLondon FilmsDistributed byUnited ArtistsRelease ...

 

This article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Churches in Palermo – news · newspapers · books · scholar · JSTOR (June 2019) (Learn how and when to remove this template message) Palermo, main city of Sicily, has a big heritage of churches which ranges from the Arab-Norman-Byzantine style to the Gothic and the Baroque styles....

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Abdullah Sahib – news · newspapers · books · scholar · JSTOR (October 2015) (Learn how and when to remove this template message) Abdullah Sahib was the Governor of Gilgit Agency during Dogra rule and was one of the earliest graduates of Muhammadan Anglo-Orienta...

 

Sudão do Sul Alcunhas?  Estrelas BrilhantesTigres Associação Associação de Futebol do Sudão do Sul Confederação CAFCECAFA Material desportivo?  AMS Clothing Treinador Stefano Cusin Capitão Peter Maker Mais participações Leon Uso Khamis (29) Melhor marcador?  James Moga (6) Uniformetitular Uniformealternativo FIFA Código SSD Ranking 163[1] Melhor colocação 134 (novembro de 2015)[1] Pior colocação 205 (setembro de 2013)[1] Elo Ranking 144 Melhor colocação 132 (j...

 

У этого топонима есть и другие значения, см. Федорцево. ДеревняФедорцево 57°56′21″ с. ш. 36°13′59″ в. д.HGЯO Страна  Россия Субъект Федерации Тверская область Муниципальный район Максатихинский Сельское поселение Рыбинское История и география Высота центра 137 м Ч...

American novelist (born 1962) Chuck PalahniukPalahniuk at BookCon in June 2018BornCharles Michael Palahniuk (1962-02-21) February 21, 1962 (age 61)Pasco, Washington, U.S.OccupationNovelistessayistAlma materUniversity of OregonPeriod1996–presentGenreFictionhorrorsatireLiterary movementMinimalism PostmodernismNotable worksFight ClubChokeRantInvisible MonstersSignatureWebsitewww.chuckpalahniuk.net Charles Michael Chuck Palahniuk (/ˈpɔːlənɪk/;[1][2] born February ...

 

Former cable television channel in Dayton, Ohio This article needs to be updated. Please help update this article to reflect recent events or newly available information. (December 2017) Television channel Miami Valley Channel (MVC)CountryUnited StatesBroadcast areaMiami Valley area of OhioNetwork UPN (1998–2006) Pax/i (secondary 2001–2006) HeadquartersDayton, OhioOwnershipOwnerCox Media GroupSister channelsWHIO-TVHistoryLaunchedSeptember 19, 1994 (1994-09-19)ClosedDecember...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!