InterContinental Bali Resort
|
Read other articles:
Questa voce sull'argomento sportivi è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Segui i suggerimenti del progetto di riferimento. Nolan Corpening Nazionalità Stati Uniti Football americano Ruolo Wide receiver Squadra Beograd Vukovi Carriera Giovanili 2014-2016North Carolina Central Eagles Squadre di club 2020 Ústí nad Labem Blades2020 Prague Black Panthers2020 United Newland Crusaders2021 Prague Black Panthers2021...
Місто Текстонангл. Thaxton Координати 34°18′11″ пн. ш. 89°10′18″ зх. д. / 34.30310000002777571° пн. ш. 89.17190000002777595° зх. д. / 34.30310000002777571; -89.17190000002777595Координати: 34°18′11″ пн. ш. 89°10′18″ зх. д. / 34.30310000002777571° пн. ш. 89.17190000002777595° зх. д. / ...
This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Italian Army ranks – news · newspapers · books · scholar · JSTOR (August 2013) (Learn how and when to remov...
Performance given between halves of a sporting event This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Halftime show – news · newspapers · books · scholar · JSTOR (July 2014) (Learn how and when to remove this template message) Half time show at the game between Frisco High vs. Centennial football game A group...
Long spear or pike introduced by Philip II of Macedon For the Bronze Age Hittite city, see Kuşaklı. For the moth genus, see Sarisa (moth). This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Sarissa – news · newspapers · books · scholar · JSTOR (July 2008) (Learn how and when to remove this template message) M...
De Afrika- en Bouwmeesterbuurt is een buurt in Nijmegen en is onderdeel aan de zuidwestkant van de wijk Heseveld. De Afrika- en Bouwmeesterbuurt zijn in oktober 2008 door de gemeenteraad van Nijmegen aangewezen als Beschermd Stadsbeeld. Deze status van beschermd stadsbeeld houdt in dat zorgvuldig moet worden omgegaan met de karakteristieke huizen en woonomgeving van de wijk. Dit beschermde stadsbeeld wordt begrensd door de Daniëlsweg, Kaaplandstraat, Generaal Smutsstraat, Joubertstraat, Cron...
Defunct political coalition in Russia You can help expand this article with text translated from the corresponding article in Russian. (April 2017) Click [show] for important translation instructions. View a machine-translated version of the Russian article. Machine translation, like DeepL or Google Translate, is a useful starting point for translations, but translators must revise errors as necessary and confirm that the translation is accurate, rather than simply copy-pasting machine-t...
Historic church in Manhattan, New York Church in New York City, United StatesCathedral of St. SavaTrinity Chapel ComplexChurch in 2011Cathedral of St. Sava40°44′37″N 73°59′24″W / 40.74361°N 73.99000°W / 40.74361; -73.99000Location15 West 25th St.Manhattan, New York CityCountryUnited StatesDenominationSerbian OrthodoxPrevious denominationEpiscopal Church (United States)Websitestsavanyc.orgHistoryFormer name(s)Trinity ChapelStatusCathedralArchitectureFunction...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
Fahne und Wappen des Kantons Schaffhausen Das Wappen des Kantons Schaffhausen stellt einen schwarzen auf den Hinterläufen frei schreitenden Bock (Widder) auf gelbem (heraldisch: goldenem) Hintergrund dar.[1] Die älteste Darstellung eines Widders bzw. «Schafs» im Zusammenhang mit Schaffhausen datiert auf 1180. Das älteste erhaltene Banner des Kantons stammt aus dem 14. Jahrhunderts und wurde bei Sempach getragen. Inhaltsverzeichnis 1 Blasonierung 2 Geschichte 3 Siehe auch 4 L...
Religion of Jainism in the Indian state of Karnataka Saavira Kambada Basadi, the 1000 pillar Jain temple at Moodabidri Part of a series onJainism Jains History Timeline Index Philosophy Anekantavada Cosmology Ahimsa Karma Dharma Mokṣa Kevala Jnana Dravya Tattva Brahmacarya Aparigraha Gunasthana Saṃsāra EthicsEthics of Jainism Mahavratas (major vows) Ahiṃsā (non-violence) Satya (truth) Asteya (non-stealing) Brahmacarya (chastity) Aparigraha (non-possession) Anuvratas (further vows) Sā...
This article includes a list of references, related reading, or external links, but its sources remain unclear because it lacks inline citations. Please help to improve this article by introducing more precise citations. (July 2023) (Learn how and when to remove this template message) 1976 Indian filmBhanwarDirected byBhappi SonieWritten byGulshan NandaStarringAshok KumarRandhir KapoorParveen BabiCinematographyJal MistryMusic byR. D. BurmanRelease date1976 (1976)CountryIndiaLanguageHindi...
Комітет порятунку за мир і порядок(КПЗМП)рос. «Комитет спасения за мир и порядок» Участь у війнах: Російське вторгнення в Україну (2022), Російсько-українська війна Сформоване: 10 березня 2022 Лідери: Володимир Сальдо; Андрій Алексеєнко; Кирило Стремоусов (до 9 листопада 2022)Штаб...
Cultural expression from Guyana Guyanese literature covers works including novels, poetry, plays and others written by people born or strongly-affiliated with Guyana. Formerly British Guiana, British language and style has an enduring impact on the writings from Guyana, which are done in English language and utilizing Guyanese Creole. Emigration has contributed to a large body of work relating the Guyanese diaspora experience.[1] History of Guyanese literature European perspective The...
Peta menunjukan lokasi Maco Maco adalah munisipalitas yang terletak di provinsi Compostela Valley, Filipina. Pada tahun 2000, munisipalitas ini memiliki populasi sebesar 65.181 jiwa atau 13.090 rumah tangga. Pembagian wilayah Secara administratif Maco terbagi menjadi 37 barangay, yaitu: Anibongan Anislagan Binuangan Bucana Calabcab Concepcion Dumlan Elizalde (Somil) Pangi (Gaudencio Antonio) Gubatan Hijo Kinuban Langgam Lapu-lapu Libay-libay Limbo Lumatab Magangit Malamodao Maripongol Mapaang...
American biochemist Melvin CalvinCalvin c. 1960sBornMelvin Ellis CalvinApril 8, 1911St. Paul, Minnesota, U.S.DiedJanuary 8, 1997(1997-01-08) (aged 85)Berkeley, California, U.S.NationalityAmericanAlma materMichigan College of Mining and TechnologyUniversity of MinnesotaKnown forCalvin cycleSpouseGenevieve Elle Jemtegaard (m. 1942, d. 1987)Children3AwardsCentenary Prize (1955)William H. Nichols Medal (1958)Nobel Prize for Chemistry (1961)Davy Medal (1964)Priestley Medal (1978)AIC...
Koordinat: 24°27′41.92″N 39°36′6.02″E / 24.4616444°N 39.6016722°E / 24.4616444; 39.6016722 Masjid Al-'AnbariyahMasjid Al-'Anbariyah terlihat dari depanLokasiLokasiMadinah, Arab SaudiKoordinat24°27′42″N 39°36′6″E / 24.46167°N 39.60167°E / 24.46167; 39.60167Koordinat: 24°27′42″N 39°36′6″E / 24.46167°N 39.60167°E / 24.46167; 39.60167{{#coordinates:}}: tidak bisa memiliki lebih dari satu ta...
Regency in Papua, IndonesiaSupiori Regency Kabupaten SupioriRegency Coat of armsMotto: Kovawes Kuker AraimaLocation Within Western New GuineaSupiori RegencyLocation in Western New Guinea and IndonesiaShow map of Western New GuineaSupiori RegencySupiori Regency (Indonesia)Show map of IndonesiaCoordinates: 0°44′S 135°35′E / 0.733°S 135.583°E / -0.733; 135.583Country IndonesiaProvincePapuaCapitalSorendiweriGovernment • RegentJules F. Waikar...
Instrument to measure electric current This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Galvanometer – news · newspapers · books · scholar · JSTOR (March 2009) (Learn how and when to remove this template message) An early D'Arsonval galvanometer showing magnet and rotating coil A galvanometer is an electromec...
This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Star News Group – news · newspapers · books · scholar · JSTOR (February 2022) (Learn how and when to remove this template message) Star News Group logo Star News Group is a media company based in Pakenham, Victoria, in Australia. Star publishes many community n...