TNFRSF8

TNFRSF8
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TNFRSF8, CD30, D1S166E, Ki-1, tumor necrosis factor receptor superfamily member 8, TNF receptor superfamily member 8
Зовнішні ІД OMIM: 153243 MGI: 99908 HomoloGene: 949 GeneCards: TNFRSF8
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243
NM_001281430
NM_152942
NM_009401
RefSeq (білок)
NP_001234
NP_001268359
NP_033427
Локус (UCSC) Хр. 1: 12.06 – 12.14 Mb Хр. 4: 144.99 – 145.04 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TNFRSF8 (англ. TNF receptor superfamily member 8) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 595 амінокислот, а молекулярна маса — 63 747[4].

Послідовність амінокислот
1020304050
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPM
GLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAW
NSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCE
PASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRL
AQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYL
DEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSP
TQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVG
SSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSG
ASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDL
PEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEE
ELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK

Кодований геном білок за функцією належить до рецепторів. Локалізований у клітинній мембрані, цитоплазмі, мембрані.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Lee S.Y., Park C.G., Choi Y. (1996). T cell receptor-dependent cell death of T cell hybridomas mediated by the CD30 cytoplasmic domain in association with tumor necrosis factor receptor-associated factors. J. Exp. Med. 183: 669—674. PMID 8627180 DOI:10.1084/jem.183.2.669
  • Boucher L.-M., Marengere L.E., Lu Y., Thukral S., Mak T.W. (1997). Binding sites of cytoplasmic effectors TRAF1, 2, and 3 on CD30 and other members of the TNF receptor superfamily. Biochem. Biophys. Res. Commun. 233: 592—600. PMID 9168896 DOI:10.1006/bbrc.1997.6509
  • Ye H., Park Y.C., Kreishman M., Kieff E., Wu H. (1999). The structural basis for the recognition of diverse receptor sequences by TRAF2. Mol. Cell. 4: 321—330. PMID 10518213 DOI:10.1016/S1097-2765(00)80334-2

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:11923 (англ.) . Процитовано 25 серпня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P28908 (англ.) . Архів оригіналу за 23 вересня 2017. Процитовано 25 серпня 2017.

Див. також

Read other articles:

World Wrestling Federation pay-per-view event SummerSlamPromotional poster featuring Shawn Michaels and Vader.PromotionWorld Wrestling FederationDateAugust 18, 1996CityCleveland, Ohio, United StatesVenueGund ArenaAttendance~17,000[1]Tagline(s)Opposites Attack!Pay-per-view chronology ← PreviousIn Your House 9: International Incident Next →In Your House 10: Mind Games SummerSlam chronology ← Previous1995 Next →1997 The 1996 SummerSlam was the ninth annual Sum...

 

Questa voce o sezione sull'argomento polimeri non cita le fonti necessarie o quelle presenti sono insufficienti. Puoi migliorare questa voce aggiungendo citazioni da fonti attendibili secondo le linee guida sull'uso delle fonti. Piatto in resina melamminica Le resine melamminiche sono resine sintetiche termoindurenti ottenute per policondensazione della formaldeide con la melammina. Si ottiene una resina incolore e inodore, resistente all'acqua, agli agenti chimici, all'abrasione, al cal...

 

Peru nos Jogos Olímpicos de Verão da Juventude de 2010 Comitê Olímpico Nacional Código do COI PER Nome Comité Olímpico Peruano«site oficial» (em espanhol)  Jogos Olímpicos de Verão da Juventude de 2010 Sede Singapura Competidores 26 em 10 esportes Porta-bandeira Kimberly García[1] Medalhas Pos.85º 0 0 1 1 Participações nos Jogos Olímpicos Verão 1936 • 1948 • 1952 • 1956 • 1960 • 1964 • 1968 • 1972 • 1976 • 1980 • 1984 • 1988 • 1992 • 1...

Langenfeld (Noordrijn-Westfalen) Stad in Duitsland Situering Deelstaat Noordrijn-Westfalen Kreis Mettmann Regierungsbezirk Düsseldorf Coördinaten 51° 7′ NB, 6° 57′ OL Algemeen Oppervlakte 41,15 km² Inwoners (31-12-2020[1]) 59.112 (1.437 inw./km²) Hoogte 47 m Burgemeester Frank Schneider (CDU) Overig Postcode 40764 Netnummers 02173, (02171), (0212) Kenteken ME Stad 5 stadsdelen Gemeentenr. 05 1 58 020 Website www.langenfeld.de Locatie van Langenfeld (Noordrijn-We...

 

O monte Sapper (em inglês: Sapper Hill; em espanhol: Cerro Zarpador) está localizado na Malvina Oriental, uma das principais Ilhas Malvinas. Possui metros de altitude e situa-se ao sul da cidade de Port Stanley, perto da estrada que a comunica com a RAF Mount Pleasant. O local está fortemente minado desde a Guerra das Malvinas.[1] Referências ↑ Russell Phillips (2014). Foi Por Pouco: Breve História Da Guerra Das Malvinas. [S.l.]: Babelcube Inc.  Este artigo sobre geografia (genér...

 

Kimora Amour Información personalNacimiento 26 de octubre de 1987 (36 años)Información profesionalOcupación Drag queen [editar datos en Wikidata] Kimora Amour es el nombre artístico de Justin Baird, una drag queen canadiense mejor conocida como competidora en la segunda temporada de Canada's Drag Race.[1]​ Primeros años Baird, de ascendencia guyanesa, es padre de un hijo adolescente y vive en el distrito de Scarborough de Toronto, Ontario. Ha sido una amiga cercana de la...

إدموند هاميلتون (بالإنجليزية: Edmond Moore Hamilton)‏    معلومات شخصية اسم الولادة Edmond Moore Hamilton الميلاد 21 أكتوبر 1904(1904-10-21)[1]يونغزتاون، أوهايو الوفاة 1 فبراير 1977 (72 سنة)لانكاستر  الجنسية  أمريكي الزوجة لي براكيت (ز. 1946–77) (حتى وفاته) الحياة العملية النوع خيال علمي، كت...

 

إن الحياة البرية في قارة إفريقيا تتميز بتنوع حيواني مذهل، وجميع الحيوانات تعيش في أنماط بيئية محيطة بالبحر والجزر والتي تجعل منها مكانا للتكاثر، واكتشاف أنواع جديدة، وعلى مر السنين كانت قارة أفريقيا مركزا للتنوع الحيواني، ويوجد النصف الأكبر من الاختلافات المتنوعة من الحي

 

Оскар Гарсія Оскар Гарсія Особисті дані Повне ім'я Оскар Гарсія Хунієнт Народження 26 квітня 1973(1973-04-26) (50 років)   Сабадель, Іспанія Зріст 182 см Вага 77 кг[1] Громадянство  Іспанія Позиція Атакувальний півзахисник Юнацькі клуби 1984–1991 «Барселона» Професіональн...

تشريح الجثة لوحة من رسم رامبرانت وتحمل عنوان: درس التشريح مع الدكتور تولب، تحاكي تشريح الجثة معلومات عامة من أنواع تسلخ،  وتشخيص  التاريخ وصفها المصدر الموسوعة السوفيتية الأرمينية،  وموسوعة بلوتو  [لغات أخرى]‏،  وقاموس بروكهاوس وإفرون الموسوعي،  وقامو...

 

UCNAvailable structuresPDBOrtholog search: PDBe RCSB List of PDB id codes2RMF, 3N96IdentifiersAliasesUCN, UI, UROC, urocortinExternal IDsOMIM: 600945 MGI: 1276123 HomoloGene: 2515 GeneCards: UCN Gene location (Human)Chr.Chromosome 2 (human)[1]Band2p23.3Start27,307,400 bp[1]End27,308,445 bp[1]Gene location (Mouse)Chr.Chromosome 5 (mouse)[2]Band5 B1|5 17.11 cMStart31,295,407 bp[2]End31,296,173 bp[2]RNA expression patternBgeeHumanMouse (orthol...

 

AEK Athens 1989–90 football seasonAEK Athens1989–90 seasonChairmanStratos GidopoulosManagerDušan BajevićStadiumAEK StadiumAlpha Ethniki3rdGreek CupRound of 32Greek Super CupWinnersGreek League CupWinnersEuropean CupSecond roundTop goalscorerLeague: Daniel Batista (15)All: Daniel Batista (17)Highest home attendance33,260 vs Marseille(1 November 1989)Lowest home attendance3,265 vs Alexandreia(2 September 1989)Average home league attendance13,741Biggest winAEK Athens 8–0 XanthiBiggest de...

Some of this article's listed sources may not be reliable. Please help this article by looking for better, more reliable sources. Unreliable citations may be challenged or deleted. (March 2015) (Learn how and when to remove this template message) High school in Clifton, Virginia, United StatesCentreville High SchoolAddress6001 Union Mill RoadClifton, Virginia 20124United StatesInformationSchool typePublic, high schoolMottoStrive for Perfection, Settle for ExcellenceFoundedFebruary 29, 19...

 

Paulinerkloster auf dem Jasna Góra in Częstochowa Schwarze Madonna von Tschenstochau,offizielle Königin Polens Jasna Góra (deutsch: Klarenberg oder Heller Berg, lateinisch: Clarus Mons) ist einer der bedeutendsten Wallfahrtsorte der römisch-katholischen Kirche inmitten der Stadt Częstochowa (Tschenstochau) in der Woiwodschaft Schlesien. Hier befindet sich im Paulinerkloster mit der wundertätigen Ikone der Schwarzen Madonna von Tschenstochau (der sogenannten Königin Polens) das größt...

 

This article includes a list of references, related reading, or external links, but its sources remain unclear because it lacks inline citations. Please help to improve this article by introducing more precise citations. (February 2014) (Learn how and when to remove this template message) NeuGRIDNeuGRID logoURLwww.neugrid2.euCurrent statusActive neuGRID is a web portal aimed to (i) help neuroscientists do high-throughput imaging research,[1] and (ii) provide clinical neurologists...

Painting by Giovanni Bellini Holy AllegoryArtistGiovanni BelliniYearc. 1490–1500Mediumoil on canvasDimensions73 cm × 119 cm (29 in × 47 in)LocationGalleria degli Uffizi, Florence The Holy Allegory is a painting by the Italian Renaissance master Giovanni Bellini, dating from c. 1490 to 1500. It is in the Uffizi gallery in Florence, Italy. History There is no documentation about the commission and the original location of the work, which is known to...

 

Uni Belanda-IndonesiaNederlands-Indonesische Unie1949–1956Belanda dan IndonesiaStatusKonfederasi antara Belanda dan IndonesiaIbu kotaAmsterdamJakartaBahasa yang umum digunakanIndonesiaBelandaBahasa DaerahAgama IslamKristenHinduBuddhaPemerintahanMonarki konfederalHoofd der Unie(Kepala Uni) • 1949–1956 Juliana Sekretaris Jenderal • 1950–1956 Peter Johannes Abram Idenburg Sejarah • Didirikan 27 Desember 1949• Uni dibubarkan 3 Mei 1956 Didahul...

 

American rock band For other uses, see The Velvet Underground (disambiguation). The Velvet UndergroundThe Velvet Underground and Nico in 1966Clockwise from top left: Lou Reed, Sterling Morrison, John Cale, Moe Tucker and NicoBackground informationAlso known as The Warlocks The Falling Spikes OriginNew York City, New York, U.S.GenresArt rock[1]experimental rock[2]avant-garde[3]proto-punk[4]Years active1964–197319901992–19931996LabelsVerveAtlanticPolydorMGMMe...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Indian Language School – news · newspapers · books · scholar · JSTOR (September 2018) (Learn how and when to remove this template message) School in Ilupeju, Lagos, NigeriaIndian Language SchoolThe Main entrance to Indian Language School, established in 1982Loc...

 

Minami-Hanna Road 南阪奈道路Route informationMaintained by West Nippon Expressway CompanyLength16.9 km (10.5 mi)ExistedMarch 2004–presentComponenthighways National Route 165 / National Route 166Major junctionsWest endMihara JunctionEast endKatsuragi Interchange LocationCountryJapanMajor citiesHabikino, Taishi, Katsuragi Highway system National highways of Japan Expressways of Japan Taishi Toll Gate (For Mihara) Minami-Hanna Road (南阪奈道路,...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!