Read other articles:

Medalla de la Campaña (1936-1939)Otorgada por el Gobierno FranquistaOtorgada por Recompensar intervenciones en operaciones bélicas o servicios en líneas de fuego.Estado ObsoletaEstablecida 27 de enero de 1937 / Cintas de la medalla [editar datos en Wikidata] La Medalla de la Campaña 1936-1939 fue una condecoración militar española otorgada entre los años 1938 y 1939, durante la Guerra Civil Española, por el Gobierno Franquista. Fue creada por el decreto 192 de 26 de enero …

Nikky Blond Información personalNombre de nacimiento Michaela SaikeOtros nombres Nikki Blond, Nikky Blonde, Nicky Blond, Nicki Blonde, Niki Blonde, Marianna, Marianna Gray, Marie AnneNacimiento 9 de marzo de 1981 (42 años)HungríaNacionalidad HúngaraEtnia CaucásicoCaracterísticas físicasAltura 1,70 m (5′ 7″)Peso 46 kg (101 lb)Medidas 34C-23-34Ojos AzulCabello RubioPecho natural SíInformación profesionalOcupación Actriz pornográfica Años activa 1999-2015Películ…

Consortium of American universities Oak Ridge Associated UniversitiesAbbreviationORAUFormation1946Legal statusActiveHeadquartersOak Ridge, TennesseeMembership 150+ colleges and universitiesPresidentAndy PageWebsitewww.orau.orgFormerly calledOak Ridge Institute of Nuclear Studies (ORINS) Oak Ridge Associated Universities (ORAU) is a consortium of American universities headquartered in Oak Ridge, Tennessee, with offices in Arvada, Colorado, Cincinnati, Ohio, and staff at other locations across the…

For a topical guide, see Outline of the United Kingdom. The following is an alphabetical list of articles related to the United Kingdom. 0-9 .uk – Internet country code top-level domain for the United Kingdom 10 Downing Street 11 Downing Street A A map of the United Kingdom Aberdeen Aberdeenshire Abortion in the United Kingdom Acts of Union 1707 Administrative geography of the United Kingdom Alternative names for the British Americans in the United Kingdom Anglosphere Anti-British sentiment Ar…

Este artigo não cita fontes confiáveis. Ajude a inserir referências. Conteúdo não verificável pode ser removido.—Encontre fontes: ABW  • CAPES  • Google (N • L • A) (Junho de 2019) A The Breckland Line é um de ferrovias do Sistema Nacional britânico de ferrovias, que interliga a Cambridge e Norwich, incluindo Brandon, Wymondham. A linha é basicamente uma ferrovia suburbana, mas que também atrai passageiros em viagens de ne…

Husaini M. AminInformasi pribadiLahir4 Desember 1970 (umur 53)Batee Iliek, Samalanga, Bireuen, AcehKebangsaanIndonesiaPartai politik  PerindoKarier militerPihak Gerakan Aceh MerdekaPertempuran/perangPemberontakan di AcehSunting kotak info • L • B Teungku H. Husaini M. Amin, S.E.[1] lebih dikenal dengan nama Tgk. Batee (lahir 4 Desember 1970) adalah tokoh pejuang GAM. Dia pernah menjabat sebagai Panglima Gerakan Aceh Merdeka wilayah Batee Iliek. Riwayat Pendid…

Die Liste der Kulturdenkmale in Hellerberge umfasst sämtliche Kulturdenkmale der Dresdner Gemarkung Hellerberge. Die Anmerkungen sind zu beachten. Diese Liste ist eine Teilliste der Liste der Kulturdenkmale in Dresden. Diese Liste ist eine Teilliste der Liste der Kulturdenkmale in Sachsen. Inhaltsverzeichnis 1 Legende 2 Liste der Kulturdenkmale in Hellerberge 3 Anmerkungen 4 Weblinks Legende Bild: Bild des Kulturdenkmals, ggf. zusätzlich mit einem Link zu weiteren Fotos des Kulturdenkmals im M…

MahenMahen pada tahun 2022LahirPetrus Canisius Hanar Mahendra17 Desember 1996 (umur 26)Jakarta, IndonesiaNama lainPetrus MahendraAlmamaterUniversitas Bunda MuliaPekerjaanPenyanyipemeranTahun aktif2019–sekarangKaryaDiskografi dan filmografiKarier musikGenrePopbaladaInstrumenVokalgitarLabelIndo Semar Sakti Petrus Canisius Hanar Mahendra (lahir 17 Desember 1996) dikenal secara profesional sebagai mononim Mahen adalah seorang penyanyi berkebangsaan Indonesia.[1] Pasca menand…

This article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Sealed album – news · newspapers · books · scholar · JSTOR (March 2021) (Learn how and when to remove this template message) 1984 box set by Yellow Magic OrchestraSealedBox set by Yellow Magic OrchestraReleasedDecember 21, 1984 (1984-12-21)RecordedJuly 1…

Tanya TateTate, 2015Lahir31 Maret 1979 (umur 44)[1]Liverpool, Inggris[1]Nama lainTanya Thomas, Sue[1]Tahun aktif2009–sekarangTinggi5 ft 6 in (1,68 m)[1]Anak1Situs webtanyatate.com Tanya Tate (lahir 31 Maret 1979) adalah seorang pemeran pornografi, model, penulis, dan cosplayer berkebangsaan Inggris.[2][3] Tate memulai karirnya pada tahun 2009, Tate mulai berkontribusi pada kolom reguler untuk majalah dewasa Inggris R…

Hospital in Dublin, Republic of IrelandFoundling Hospital, DublinDining Hall, Foundling Hospital, Dublin.Shown in DublinGeographyLocationDublin, Republic of IrelandCoordinates53°20′31″N 6°17′45″W / 53.3420°N 6.2958°W / 53.3420; -6.2958HistoryOpened1704Closed1835 The Foundling Hospital was a hospital for abandoned children in Dublin, Ireland which was established as part of the South Dublin Union. History The Foundling Hospital of Dublin was opened in 1704.[…

Pour les articles homonymes, voir Villeneuve. Villeneuve-les-Corbières Villeneuve-les-Corbières au milieu de son vignoble. Blason Administration Pays France Région Occitanie Département Aude Arrondissement Narbonne Intercommunalité Communauté de communes Corbières Salanque Méditerranée Maire Mandat Alain Izard 2020-2026 Code postal 11360 Code commune 11431 Démographie Gentilé Villenovaises et Villenovais ou Villeneuvoises et Villeneuvois Populationmunicipale 251 hab. (2020 ) Dens…

сельское поселениеТемижбекское сельское поселение Флаг 45°26′45″ с. ш. 40°50′50″ в. д.HGЯO Страна  Россия Входит в Кавказский район Включает 1 населённый пункт Адм. центр станица Темижбекская Глава МО Никитенко Анатолий Николаевич История и география Площадь 125,…

Political party in Lithuania Liberal and Centre Union Liberalų ir centro sąjungaLeaderAlgis ČaplikasFounded31 May 2003Dissolved12 July 2014Merger ofLLS, LCS, MKDPMerged intoLithuanian Freedom UnionHeadquartersVilniaus g. 22/1, VilniusIdeologyConservative liberalismLiberalism[1]Political positionCentre-rightWebsitewww.lics.ltPolitics of LithuaniaPolitical partiesElections The Liberal and Centre Union (Lithuanian: Liberalų ir centro sąjunga, LiCS) was a conserv…

Опис Емблема ФК Система-Борекс Джерело значок Час створення 1990-ті Автор зображення ФК Система-Борекс Ліцензія Відповідно до статті 8 Закону України про авторське право і суміжні права, наступні об'єкти не охороняються авторським правом: 1) повідомлення про новини або інші �…

Historical dynasty based in Ghazni and Gardez Lawik dynastyc.750 CE–977 CE Ghazni was the power-center of the Lawik dynasty. Citadel of Ghazni pictured above LAWIKDYNASTYSAFFARIDSSAMANIDSABBASIDCALIPHATEBYZANTINEEMPIREGUJARA-PRATIHARAPALA EMPIREUTPALADYNASTYHINDUSHAHISclass=notpageimage| Approximate location of the Lawik dynastyHindu ShahisLAWIKSSamarkandHeratSAFFARIDS/SAMANIDS/GhaznavidsBalkhKandaharGhazniGardezKabulHundUTPALADYNASTYKHUDAHSBukharaAFSHINSBostclass=notpageimage| The Lawik Dynas…

Regional divisions in Haryana This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article may be in need of reorganization to comply with Wikipedia's layout guidelines. Please help by editing the article to make improvements to the overall structure. (October 2019) (Learn how and when to remove this template message) This article may have too many section headers. Please help consolidate th…

У этого термина существуют и другие значения, см. Клубника (значения). Ягоды клубники (плоды земляники зелёной). Клубни́ка (от др.-рус. клуб «клубок, шарообразное тело») — название крупноплодных видов растений рода Земляника (Fragaria) семейства Розовые[1], а также их пло�…

American comedy TV series about an acerbic rehab counselor LoudermilkGenreComedy dramaCreated by Peter Farrelly Bobby Mort Directed byPeter FarrellyStarring Ron Livingston Will Sasso Anja Savcic Laura Mennell Opening themeStand on the Horizon by Franz FerdinandComposerDave PalmerCountry of originUnited StatesOriginal languageEnglishNo. of seasons3No. of episodes30 (list of episodes)ProductionExecutive producers Peter Farrelly Bobby Mort Christopher Long Shane Elrod Bart Peters Mark Burg David Gu…

Sebuah plang multi-bahasa (Ibrani, Arab, Inggris, dan Rusia) di Kementerian Dalam Negeri/Kementerian Urusan Imigran Wazir (Arab: وزير- wazīr; bahasa Inggris: vizier) adalah seorang penasihat atau menteri (politik dan atau keagamaan) berkedudukan tinggi, biasanya ini dengan mudah ditemukan dalam sistem monarki Islam seperti Khalifah, Amir, Malik (raja) atau Sultan. Istilah ini berasal dari bahasa Persia yang secara harfiah berarti pembantu. Referensi Etymology OnLine Ark, dynasties i…