Read other articles:

Виновная мать, или Второй ТартюфL’Autre Tartuffe, ou la Mère coupable Титульный лист издания 1794 года Жанр театр Автор Пьер Огюстен Бомарше Язык оригинала французский Дата первой публикации 1792  Медиафайлы на Викискладе «Преступная мать, или Второй Тартюф» (фр. L’Autre Tartuffe, ou la Mère coupab...

 

У Вікіпедії є статті про інші географічні об’єкти з назвою Кордова. Місто Кордоваангл. Cordova Координати 33°26′07″ пн. ш. 80°55′15″ зх. д. / 33.43543000002777177° пн. ш. 80.92093000002778069° зх. д. / 33.43543000002777177; -80.92093000002778069Координати: 33°26′07″ пн. ш. 80°55′15″ зх...

 

Egon Krenz, 1984 Unterschrift von Egon Krenz Egon Rudi Ernst Krenz[1] (* 19. März 1937 in Kolberg, Pommern) ist ein ehemaliger deutscher Politiker der SED. 1983 in das Politbüro des ZKs der SED berufen, war er vom 18. Oktober bis zum 6. Dezember 1989 als Nachfolger Erich Honeckers Generalsekretär des ZKs der SED sowie ab 24. Oktober bis zum selben Enddatum Staatsratsvorsitzender und Vorsitzender des Nationalen Verteidigungsrates der DDR. Bei seiner Fernsehrede aus diesem Anlass fü...

Der Anfang von Peuerbachs Theoricae novae planetarum in der Handschrift Krakau, Biblioteca Jagiellońska, Ms. 599, fol. 1r (15. Jahrhundert) Georg von Peuerbach, Theoricae novae planetarum, Ausgabe Paris 1515 Georg von Peuerbach (auch Georg Purbach, eigentlich Georg Aunpekh, Gelehrtenname Purbachius; * 30. Mai 1423 in Peuerbach in Oberösterreich; † 8. April 1461 in Wien) war Humanist und Astronom an der Wiener Universität. Durch eine verbesserte Planetentheorie wurde er ein Wegbereiter de...

 

Arabic dialect of Iraq, Syria, Turkey and Iran North Mesopotamian ArabicMoslawi Arabic, Mesopotamian Qeltu Arabic, Qeltu Arabic, Syro-Mesopotamian Arabicلهجة موصليةNative toIraq, Iran, Syria, Turkey, CyprusSpeakers10 million (2020)[1]Language familyAfro-Asiatic SemiticWest SemiticCentral SemiticArabicMesopotamianNorth Mesopotamian ArabicDialects Anatolian Arabic Judeo-Iraqi Arabic Cypriot Arabic Writing systemArabic alphabetLanguage codesISO 639-3aypGlottolognort31...

 

For other uses, see TRADOC (disambiguation). Training and Doctrine CommandInsignia of the TRADOCActive1998 – presentCountry LithuaniaBranch Lithuanian Land ForceTypeArmy CommandRolemilitary recruitmentbasic military training and educationGarrison/HQVilniusNickname(s)TRADOCCommandersCurrentcommanderColonel Mindaugas SteponavičiusMilitary unit The Training and Doctrine Command (TRADOC) is a training-oriented formation in the Lithuanian Armed Forces, focused on implementing military...

1999 novel by Dave Wolverton The Rising Force AuthorDave WolvertonCover artistCliff NielsenCountryUnited StatesLanguageEnglishSeriesJedi ApprenticeCanon CGenreScience fictionPublisherScholasticPublication dateMay 3, 1999Media typePaperbackPages171ISBN0-590-51922-0Preceded byDarth Bane: Dynasty of Evil Followed byThe Dark Rival  The Rising Force by Dave Wolverton is the first in a series of young reader novels called Jedi Apprentice. The only novel of the series t...

 

Bishopwearmouth CemeteryCommonwealth war graves in Bishopwearmouth CemeteryDetailsEstablished1856LocationSunderlandCountryUnited KingdomCoordinates54°53′55″N 1°25′15″W / 54.89872°N 1.42088°W / 54.89872; -1.42088TypePublicOwned bySunderland City CouncilSize80 acres (32 ha)Find a GraveBishopwearmouth Cemetery Bishopwearmouth Cemetery is a cemetery in Sunderland, Tyne and Wear, England. It lies between Hylton Road and Chester Road (A183 road). History Due...

 

Indian dynasty (c. 225 – c.340) For other uses, see Ikshvaku (disambiguation). Ikshvakus of VijayapuriEarly 3rd century–early 4th centurySouth Asia350 CEYAUDHEYASARJUNAYANASMADRAKASMALAVASIKSHVAKUSKALABHRASWESTERNGANGASTOCHARIANSKADAMBASPALLAVASLITTLEKUSHANSLICCHAVISWESTERNSATRAPSSASANIANHINDMAHAMEGHA-VAHANASKAMARUPAGAUDASAMATATASDAVAKAKIDARITESABHIRASVAKATAKASGUPTAEMPIREKUSHANO-SASANIANSSAKASTANTURANMAKRANSASANIANEMPIRE  ◁ ▷ Location of the Andhra Ikshvakus in c. 350 CECapitalVi...

American actress (1960– ) Jennifer RunyonRunyon at the Chiller Theatre Expo in 2017BornJennifer Victoria Runyon (1960-04-01) April 1, 1960 (age 63)Chicago, Illinois, U.S.OccupationActressYears active1980–1993, 2015-presentSpouse Todd Corman ​(m. 1991)​Children2ParentJim Runyon (father) Jennifer Victoria Runyon (born April 1, 1960) is an American actress. She made her feature-film debut in the slasher film To All a Goodnight (1980), and went on to hav...

 

Species of turtle Chicken turtleTemporal range: 5–0 Ma PreꞒ Ꞓ O S D C P T J K Pg N ↓ Pliocene–recent[1] Chicken turtle on land Conservation status Secure (NatureServe)[2] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Reptilia Order: Testudines Suborder: Cryptodira Superfamily: Testudinoidea Family: Emydidae Subfamily: Deirochelyinae Genus: Deirochelys Species: D. reticularia Binomial name Deirochelys reticula...

 

Artikel ini memberikan informasi dasar tentang topik kesehatan. Informasi dalam artikel ini hanya boleh digunakan hanya untuk penjelasan ilmiah, bukan untuk diagnosis diri dan tidak dapat menggantikan diagnosis medis. Perhatian: Informasi dalam artikel ini bukanlah resep atau nasihat medis. Wikipedia tidak memberikan konsultasi medis. Jika Anda perlu bantuan atau hendak berobat, berkonsultasilah dengan tenaga kesehatan profesional. Stres atau cekaman adalah gangguan mental yang dihadapi seseo...

Upper house of the Minnesota legislature Minnesota Senate93rd Minnesota LegislatureTypeTypeUpper house of the Minnesota Legislature Term limitsNoneHistoryNew session startedJanuary 3, 2023 (2023-01-03)LeadershipPresidentBobby Joe Champion (DFL) since January 3, 2023 President pro temporeAnn Rest (DFL) since January 3, 2023 Majority LeaderKari Dziedzic (DFL) since January 3, 2023 Minority Leader Mark Johnson (R) since January 3, 2023 StructureSeats67Political groups  DFL (3...

 

L'algoritmo di Ada Lovelace (nata Ada Byron) permette di calcolare i numeri di Bernoulli. Questo algoritmo è noto soprattutto per essere stato il primo programma della storia dell'informatica. Nota G, diagramma di Ada Lovelace: fu il primo algoritmo per computer pubblicato Indice 1 La formula utilizzata 2 Note 3 Bibliografia 4 Voci correlate La formula utilizzata Come si vede dal diagramma in figura e dal testo relativo disponibile in lingua inglese[1], Ada Lovelace nell'implementare...

 

1998 single by Jerry RiveraEseSingle by Jerry Riverafrom the album De Otra Manera ReleasedOctober 5, 1998 (1998-10-05)Studio Extreme Music-Musica Futura (Miami, FL) Mixing Recording Studio Telesound (San Juan, Puerto Rico) GenreLatin pop · Salsa · bolero · latin balladLength3:25 (Ballad version)4:19 (Salsa version)LabelSony DiscosSongwriter(s)Alejandro Jaén · William PazProducer(s)Alejandro Jaén · J. Salazar · Ramón B. SánchezJerry Rivera singles chronology Vuela Lib...

1998 compilation album by Bing CrosbyThe Voice of Christmas: The Complete Decca Christmas SongbookCompilation album by Bing CrosbyReleasedOctober 6, 1998Recorded1935–1956GenreChristmasLabelDecca The Voice of Christmas: The Complete Decca Christmas Songbook is a two-disc collection of Christmas music recorded by Bing Crosby for the Decca label between 1935 and 1956, released by Universal Music Group on October 6, 1998. Crosby was the first popular singer to record Christmas songs, an...

 

Лейкіт Стенфілдангл. Lakeith Stanfield Псевдо Lakeith StanfieldНародився 12 серпня 1991 (32 роки)(19910812)[1][2]Сан-Бернардіно, Каліфорнія, США[3]Країна  СШАДіяльність актор, телеактор, кіноактор, актор театру, репер, поетГалузь акторське мистецтво[4] і музик...

 

Тетраподоморфы Eusthenopteron foordiЧетвероногие в широком смысле. Сверху: зелёная литория, акантостега; Снизу: обыкновенная сипуха, обыкновенная лисица Научная классификация Домен:ЭукариотыЦарство:ЖивотныеПодцарство:ЭуметазоиБез ранга:Двусторонне-симметричныеБез ранга:Вто...

Бібліотека та Архів КанадиLibrary and Archives CanadaBAC[4][5] і LAC[4][6] 45°25′11″ пн. ш. 75°42′29″ зх. д. / 45.4197222222499946° пн. ш. 75.70805555558334277° зх. д. / 45.4197222222499946; -75.70805555558334277Координати: 45°25′11″ пн. ш. 75°42′29″ зх. д. / 45.4197222222499946°&#...

 

Analisi di laboratorio di una delle mummie di Llullaillaco, bambini incas sacrificati sulla cima del vulcano Llullaillaco, nella provincia di Salta (Argentina) Il sacrificio umano è l'atto di uccidere uno o più esseri umani, solitamente come offerta a una divinità, come parte di un rito religioso. Il sacrificio umano è stato praticato da diverse culture antiche lungo il corso della storia. Nelle culture antiche si parlava di sacrificio umano quando a una divinità venivano immolati degli ...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!