Read other articles:

L

Lihat L, l di Wiktionary, kamus gratis. Alfabet Latindasar ISO AaBbCcDdEeFfGgHhIiJjKkLlMmNnOoPpQqRrSsTtUuVvWwXxYyZz lbs Halaman ini memuat artikel tentang huruf L dalam alfabet Latin. Untuk penggunaan lainnya, lihat L (disambiguasi). L adalah huruf ke-12 dalam alfabet Latin. Huruf ini disebut el, dibaca [[Bantuan:Pengucapan|[ɛl]]]. Sejarah Hieroglif Mesirtongkat →Proto-Semitiklamd →Fenisialamd →Yunani Kunolambda →Yunani Modernlambda →EtruriaL →Latin ...

 

هذه المقالة تحتاج للمزيد من الوصلات للمقالات الأخرى للمساعدة في ترابط مقالات الموسوعة. فضلًا ساعد في تحسين هذه المقالة بإضافة وصلات إلى المقالات المتعلقة بها الموجودة في النص الحالي. (ديسمبر 2019) دوري جنوب إفريقيا لكرة القدم 1999–2000 تفاصيل الموسم دوري جنوب أفريقيا لكرة القد...

 

Die Bode Galerie & Edition ist eine Galerie, Katalog- und Grafikedition für moderne und zeitgenössische Kunst in Nürnberg und Daegu (Südkorea). Inhaltsverzeichnis 1 Geschichte 2 Edition 3 Veröffentlichungen 4 Weblinks 5 Einzelnachweise Geschichte Die Galerie Bode & Edition wurde 1984 in Nürnberg von dem deutschen Galeristen und Kunstverleger Klaus D. Bode (* 1962) gegründet. Klaus D. Bode ist Gründungsmitglied des Bundesverbandes der deutschen Kunstverleger e.V., für welchen ...

Olympic boxing tournament Middleweight boxingat the Games of the XVII OlympiadVenuePalazzo dello SportDates26 August – 5 SeptemberCompetitors25 from 25 nationsMedalists Eddie Crook, Jr.  United States Tadeusz Walasek  Poland Yevgeny Feofanov  Soviet Union Ion Monea  Romania← 19561964 → Boxing at the1960 Summer OlympicsFlyweightmenBantamweightmenFeatherweightmenLightweightmenLight welterweightmenWelterweightmenLight middleweightmenMiddlewei...

 

Alex Morgan of the United States scored a joint-record 5 goals in a record 13–0 win against Thailand. This is a list of all hat-tricks scored during FIFA Women's World Cups; that is, the occasions when a footballer has scored three or more goals in a single football World Cup match (not including FIFA Women's World Cup qualification matches). So far, 27 hat-tricks have been scored in over 270 matches in the 9 editions of the World Cup tournament. As FIFA is the governing body of association...

 

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

Кандинський Василь Васильовичрос. Василий Васильевич Кандинский Народився 4 (16) грудня 1866[1][2][…]Москва, Російська імперія[4][5][…]Помер 13 грудня 1944(1944-12-13)[4][7][…] (77 років)Неї-сюр-Сен, Франція[4][5][6]·інсультПоховання Neuilly-sur-Seine New Communal Cemeteryd&#...

 

Subfamily of bees Nomiinae Dieunomia heteropoda Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Arthropoda Class: Insecta Order: Hymenoptera Family: Halictidae Subfamily: Nomiinae Nomiinae is a subfamily of sweat bees in the family Halictidae. There are about 11 genera and at least 550 described species in Nomiinae.[1][2] Nomia universitatis Genera These 11 genera belong to the subfamily Nomiinae: Dieunomia Cockerell, 1899 i c g b Halictonomia Pauly, 1980...

 

River in South Yorkshire, England River RivelinThe river at the site of Walkley Bank Tilt.LocationCountryEnglandPhysical characteristicsSource  • locationPennines Length8 miles (13 km) The River Rivelin is a river in Sheffield, South Yorkshire, England. It rises on the Hallam moors, in north west Sheffield, and joins the River Loxley (at Malin Bridge). The Rivelin Valley, through which the river flows, is a 3+1⁄2-mile-long woodland valley which includes th...

Chinese video sharing website This article is about a Shanghai-based Chinese video sharing website. For the water dam in Indonesia, see Bili-Bili Dam. BilibiliLogo used since 2009Type of siteVideo sharingAvailable inChinese (simplified)Chinese (traditional)English (global edition only)Indonesian (global edition only)Thai (global edition only)Vietnamese (global edition only)Malay (global edition only)Traded asNasdaq: BILI SEHK: 9626FoundedJune 2009; 14 years agoHeadquarters...

 

Kontributor utama artikel ini tampaknya memiliki hubungan dekat dengan subjek. Artikel ini mungkin memerlukan perapian untuk mematuhi kebijakan konten Wikipedia, terutama dalam hal sudut pandang netral. Silakan dibahas lebih lanjut di halaman pembicaraan artikel ini.Artikel ini kemungkinan ditulis dari sudut pandang penggemar dan bukan sudut pandang netral. Mohon rapikan untuk menghasilkan standar kualitas yang lebih tinggi dan untuk membuat pemakaian nada yang netral. (Pelajari cara dan kapa...

 

У этого термина существуют и другие значения, см. Wolfenstein (значения).Wolfenstein II: The New Colossus Обложка игры Разработчики MachineGames Panic Button (Switch-порт) Издатель Bethesda Softworks Часть серии Wolfenstein Дата анонса 12 июня 2017 года Даты выпуска Windows, PlayStation 4, Xbox One: 27 октября 2017 года[1] Nintendo Switch: 29 июня 20...

QueensBorough of New York CityQueens CountyLetak Queens ditandai warna oranye. Bandara terdekat juga telretak di Queens.NegaraAmerika SerikatNegara BagianNew YorkCountyQueensKotaNew York CityDihuni1683Pemerintahan • JenisBorough (New York City) • Presiden BoroughHelen Marshall (D) • Jaksa DistrikRichard BrownLuas • Total178,28 sq mi (46,170 km2) • Luas daratan109,24 sq mi (28,290 km2) • Luas ...

 

Operation SmileFormation1982; 41 years ago (1982)FoundersWilliam P. Magee Jr.Kathleen S. MageeTypeNonprofitHeadquartersVirginia Beach, Virginia, U.S.CEOWilliam P. Magee Jr.PresidentKathleen S. MageeWebsitewww.operationsmile.org Operation Smile is a nonprofit medical service organization founded in 1982 by William P. Magee Jr. and his wife Kathleen (Kathy) S. Magee. It is headquartered in Virginia Beach, Virginia. In addition to providing cleft lip and palate repair surgeries...

 

Герман СтефанссонНародився 25 грудня 1968(1968-12-25) (54 роки)Рейк'явік, ІсландіяКраїна  ІсландіяДіяльність письменник, композиторЗнання мов ісландська Герман Стефансон (нар. 25 липня 1968, Рейк'явік, Ісландія) — ісландський письменник, музикант і поет. Його роман «Oblivion» був...

Дзиттэдзюцу十手術 Страна  Япония Основатель неизвестен Родоначальное БИ Различные корю Дзиттэдзюцу (яп. 十手術 Jittejutsu, «искусство жезла») или Дзюттэдзюцу (англ. Juttejutsu) — японское искусство ведения боя при помощи дзюттэ. История Дзиттэдзюцу зародилось и получило...

 

Extended Indian reservation for Anglo-Indians The Constitution (Ninety-fifth Amendment) Act, 2009Parliament of India Long title An Act further to amend the Constitution of India. Citation95th AmendmentTerritorial extentIndiaPassed byLok SabhaPassed3 August 2009Passed byRajya SabhaPassed4 August 2009Assented to18 January 2010Signed byPratibha PatilCommenced25 January 2010Date of expiry26 January 2020Legislative historyFirst chamber: Lok SabhaBill titleThe Constitu...

 

Elections in Massachusetts General 1942 1944 1946 1948 1950 1952 1954 1956 1958 1960 1962 1964 1966 1970 1974 1978 1982 1986 1990 1994 1998 2002 2006 2008 2010 2012 2014 2016 2018 2020 2022 Federal government U.S. President 1788–89 1792 1796 1800 1804 1808 1812 1816 1820 1824 1828 1832 1836 1840 1844 1848 1852 1856 1860 1864 1868 1872 1876 1880 1884 1888 1892 1896 1900 1904 1908 1912 1916 1920 1924 1928 1932 1936 1940 1944 1948 1952 1956 1960 1964 1968 1972 1976 1980 1984 1988 1992 1996 200...

For 1863 camps on the battlefield and the 1861 Porter Guards camp, see Camp Letterman, Camp Harper, National Cemetery consecration, and 10th Regiment New York Cavalry. Contents Camp Crawford Camp Stuart Camp, US Troops 1919 convoys CCC camps CPTP school Camp Eisenhower Camp Meade 1913 reunion Camp Colt Camp Renaissance References Gettysburg Battlefield camps after the American Civil War were used by the Pennsylvania National Guard, Civil War veterans, the US Marine Corps, the Civilian Conserv...

 

American politician (born 1979) Ben Toma55th Speaker of the Arizona House of RepresentativesIncumbentAssumed office January 9, 2023Preceded byRussell BowersMember of the Arizona House of Representativesfrom the 27th districtIncumbentAssumed office January 9, 2023Serving with Kevin PaynePreceded byPhil LovasMajority Leader of the Arizona House of RepresentativesIn officeJanuary 11, 2021 – January 9, 2023Preceded byWarren PetersenSucceeded byLeo BiasiucciM...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!