მსოფლიო საფეხბურთო ჩემპიონატი 1998
|
Read other articles:
Superorder of mice, humans, their most recent common ancestor, and all its descendants EuarchontogliresTemporal range: Paleocene–Present PreꞒ Ꞓ O S D C P T J K Pg N From top to bottom (left): rat, treeshrew, colugo; (right) hare, macaque with human. Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Mammalia Magnorder: Boreoeutheria Superorder: EuarchontogliresMurphy et al., 2001[1] Subgroups †Apatemyidae? Gliriformes †Anagaloidea †Arctos...
DART Light Rail station in Dallas This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article relies excessively on references to primary sources. Please improve this article by adding secondary or tertiary sources. Find sources: LBJ/Central station – news · newspapers · books · scholar · JSTOR (May 2021) (Learn how and when to remove this templat...
Real estate company in Hong Kong Great Eagle Holdings LimitedGreat Eagle Centre (left), the company's headquarters, and Harbour Centre (right)TypePublicTraded asSEHK: 41IndustryHotels and real estate[1]Founded1963 in Hong KongFounderLo Ying-shek and Lo To Lee KwanHeadquartersGreat Eagle Centre, Hong KongArea servedWorldwideKey peopleLo Ka-shui (Chairman and Managing Director)Revenue HK$7.83 billion (2021)[2]Operating income HK$(483) million (2021)[2]Net income HK$...
Mumbai Central – HapaAC Duronto ExpressOverviewService typeDuronto ExpressFirst service22 December 2009; 13 years ago (2009-12-22)Current operator(s)Western RailwayRouteTerminiMumbai Central (MMCT)Hapa (HAPA)Stops3Distance travelled815 km (506 mi)Average journey time12 hrs 30 minsService frequencyDailyTrain number(s)12267 / 12268On-board servicesClass(es)AC 1st Class, AC 2 tier, AC 3 tier,Seating arrangementsNoSleeping arrangementsYesCatering facilitiesNoObservat...
Halaman ini berisi artikel tentang studi struktural di bidang teknik. Untuk penggunaan ilmu sosial, lihat strukturalisme. [1]Analisis struktur merupakan ilmu untuk menentukan efek dari beban pada struktur fisik dan komponennya. Adapun cabang pemakaiannya meliputi analisis bangunan, jembatan, perkakas, mesin, tanah, dll. Analisis struktur menggabungkan bidang mekanika teknik, teknik material dan matematika teknik untuk menghitung deformasi struktur, kekuatan internal, tegangan, tekanan...
Marian Bartłomiej Radwański podpułkownik dyplomowany piechoty Data i miejsce urodzenia 23 sierpnia 1893 Rzeszów Przebieg służby Siły zbrojne Armia Austro-Węgier Wojsko Polskie Polskie Siły Zbrojne Główne wojny i bitwy I wojna światowawojna polsko-bolszewicka II wojna światowa kampania wrześniowa Odznaczenia Marian Bartłomiej Radwański vel Kluska[a] (ur. 23 sierpnia 1893 w Rzeszowie) – podpułkownik dyplomowany piechoty Wojska Polskiego i Polskich Sił Zbrojnych, kawaler...
Vidhan Sabha constituencyDarbhanga Rural Assembly constituencyConstituency No. - for the Bihar Legislative AssemblyConstituency detailsCountryIndiaRegionEast IndiaStateBihar Elected year2020 Assembly constituency in Bihar, IndiaDarbhanga RuralAssembly constituencyDarbhanga RuralLocation in BiharCoordinates: 26°08′58″N 85°51′03″E / 26.14944°N 85.85083°E / 26.14944; 85.85083Country IndiaStateBiharDistrictDarbhangaConstituency No.82TypeOpenLok Sabha const...
Grammatical construct in which a noun modifies another noun Look up noun adjunct in Wiktionary, the free dictionary. In grammar, a noun adjunct, attributive noun, qualifying noun, noun (pre)modifier, or apposite noun is an optional noun that modifies another noun; functioning similarly to an adjective, it is, more specifically, a noun functioning as a pre-modifier in a noun phrase. For example, in the phrase chicken soup the noun adjunct chicken modifies the noun soup. It is irrelevant whethe...
Shape with five sides This article is about the geometric figure. For the headquarters of the United States Department of Defense, see The Pentagon. For other uses, see Pentagon (disambiguation). PentagonA cyclic pentagonEdges and vertices5 In geometry, a pentagon (from the Greek πέντε pente meaning five and γωνία gonia meaning angle[1]) is any five-sided polygon or 5-gon. The sum of the internal angles in a simple pentagon is 540°. A pentagon may be simple or self-intersec...
Sri Lanka Navy special forces unit Special Boat Squadronවිශේෂ යාත්රා බලගණය (Sinhala)சிறப்பு படகு படை (Tamil)SBS personnel on Independence day paradeActive1993–presentCountrySri LankaBranchSri Lanka NavyTypeNaval Special ForcesRoleSpecial operationsMaritime counter-terrorismPart ofSpecial operations, Sri Lanka NavyNickname(s)SBS, Black Kits, Sea ZombiesMotto(s)Fortune Favours the Brave (Fortes Fortuna Iuvat)Engagem...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
Old Norse term for a type of shamanistic sorcery A depiction of Freyja. Within Norse paganism, Freyja was the deity primarily associated with seiðr In Old Norse, seiðr (sometimes anglicized as seidhr, seidh, seidr, seithr, seith, or seid) was a type of magic which was practised in Norse society during the Late Scandinavian Iron Age. The practice of seiðr is believed to be a form of magic which is related to both the telling and the shaping of the future. Connected to the Old Norse religion...
Municipality in Nordeste, BrazilMarcelino VieiraMunicipality FlagSealCountry BrazilRegionNordesteStateRio Grande do NorteMesoregionOeste PotiguarPopulation (2020 [1]) • Total8,336Time zoneUTC−3 (BRT) Marcelino Vieira is a municipality in the state of Rio Grande do Norte in the Northeast region of Brazil.[2][3][4][5] See also List of municipalities in Rio Grande do Norte References ^ IBGE 2020 ^ Divisão Territorial do Brasil ...
Tamim bin Hamad al-TsaniEmir QatarBerkuasa25 Juni 2013–sekarangPendahuluHamad bin Khalifa al-TsaniPerdana Menteri Lihat daftar Hamad bin Jassim bin Jaber Al Thani Informasi pribadiKelahiran3 Juni 1980 (umur 43)Doha, QatarWangsaAl ThaniAyahHamad bin Khalifa al-TsaniIbuMuzah binti Nassir al-MissnadPasanganJawahar binti Hamad al-Tsani (m. 2005)Anoud binti Mana Al-Hajri (m. 2009)Noora binti Hathal Al-Dosari (m. 2014)AnakLihatAgamaIslam Sunni Syekh Tamim bin Hamad bin Khalifa al-Tsani (Arab...
Carved dragon post below a dragon beam - The Old Wool Hall, Lavenham - geograph.org.uk - 1546714 The diagonal beams are dragon beams. Chapel of Our Lady of Good Hope, Azerat, France Dragon beam is a horizontal, diagonal beam in the corner(s) of some traditional timber-framed buildings. The term is commonly used in both hip roof framing and jettying. Older publications may use the synonyms dragging beam, dragging piece, dragging tie, dragon piece or dragon tie. Inconsistencies in modern usage ...
Cet article est une ébauche concernant Paris. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. Pour les articles homonymes, voir Quartier Notre-Dame et Notre-Dame-des-Champs. Quartier Notre-Dame La cathédrale Notre-Dame de Parisqui donne son nom au quartier. Administration Pays France Région Île-de-France Ville Paris Arrondissement municipal 4e Démographie Population 3 029 hab. (2016 [1]) Densité 7...
Technical college in West Bengal, India West Bengal Survey InstituteBandel Survey InstituteTypePublicEstablished1947Academic staffSurvey, Civil, GIS-GPSLocationBandel, West Bengal, IndiaWebsitehttps://polytechnic.wbtetsd.gov.in/wbsibandel West Bengal Survey Institute, or WBSI, is a public technical education college located in Bandel, West Bengal. It is affiliated with West Bengal State Council of Technical Education (WBSCTE) [1] and approved by All India Council For Technical Educati...
American alliance of street gangs Folks NationFounded1978; 45 years ago (1978)FounderLarry HooverFounding locationStateville Correctional Center, Crest Hill, Illinois, U.S.Years active1978–presentTerritoryNationwideEthnicityAllLeader(s)Larry HooverCriminal activitiesDrug trafficking, burglary, extortion, homicideAlliesVarious Crips factionsRivalsPeople Nation The Folks Nation is an alliance of street gangs originating in Chicago, established in 1978.[1] T...
2013 studio album by Milk MusicCruise Your IllusionStudio album by Milk MusicReleasedApril 2, 2013 (2013-04-02)GenreAlternative rock, punk rock, indie rockLength42:44LabelFat PossumProducerMilk MusicMilk Music chronology Almost Live(2012) Cruise Your Illusion(2013) USA '13(2014) Cruise Your Illusion is the debut studio album by American punk rock group Milk Music. It was released on April 2, 2013, via Fat Possum Records on CD and digital formats. The vinyl version of th...
1991 San Marino Grand PrixRace detailsRace 12 of 15 races in the1991 Grand Prix motorcycle racing seasonDate18 August 1991Official nameGran Premio di San Marino[citation needed]LocationAutodromo Internazionale del MugelloCoursePermanent racing facility5.245 km (3.259 mi)500 ccPole positionRider Kevin SchwantzTime 1:54.276Fastest lapRider Kevin SchwantzTime 1:54.461PodiumFirst Wayne RaineySecond Kevin SchwantzThird Mick Doohan250 ccPole positionRider Helmut BradlT...