Uronematidae

Les Uronematidae sont une famille de Ciliés de la classe des Oligohymenophorea et de l'ordre des Philasterida.

Étymologie

Le nom de la famille vient du genre type Uronema, composé du préfixe ur, « queue », et du suffixe nema, « fil, filament », en référence au cil caudal (parfois plusieurs cils caudaux) que ce cilié possède[1].

Description

Les Uronematidae ont une petite taille (< 80 μm). Leur forme varie entre strictement ovoïde et allongée-ovoïde, avec leur extrémité antérieure légèrement aplatie et leur pôle antérieur visiblement nu. Ils vivent en natation libre. Leur ciliation somatique est holotriche (c. à d. uniforme) et clairsemée. Ils possèdent un ou plusieurs cils caudaux. Leur région buccale est une dépression antérieure peu profonde. On y observe des polykinétides oraux réduits, avec le polykinétide oral 1 typiquement non cilié et une ciliature buccale relativement peu visible sur les deux autres polykinétides oraux. Leur scutica[note 1] consiste en un arrangement triangulaire de kinétosomes ciliés dans le méridien principal. Leur macronoyau est globulaire à ellipsoïde. Micronoyau, vacuole contractile et cytoprocte (zone anale) sont présents. Ils sont bactérivores[1].

Habitat et répartition

Les Uronematidae vivent dans des habitats marins, d’eau douce et parfois terrestres[1]. Ils ont une très large répartition mondiale[2].

Liste des genres

Selon le World Register of Marine Species (13 octobre 2023)[3] :

Selon GBIF (13 octobre 2023)[4] :

Systématique

Le nom valide complet (avec auteur) de ce taxon est Uronematidae Thompson, 1964[3].

Bibliographie

Publication originale

  • (en) J.C. Thompson, « A redescription of Uronema marinum, and a proposed new family Uronematidae », Virginia Journal of Science, vol. 15(2),‎ , p. 80-85 (ISSN 0042-658X, lire en ligne Accès payant, consulté le )

Liens externes

Sur les autres projets Wikimedia :

Notes et références

Notes

  1. Scutica : structure ciliaire somatique transitoire, seulement présente pendant la stomatogenèse.

Références

Read other articles:

La Teoría de la actividad es una metateoría, paradigma, o marco de estudio psicológico, con raíces dadas por la psicología histórico-cultural del psicólogo soviético Lev Vygotski. Sus fundadores fueron Alekséi Leóntiev (1903-1979) y Serguéi Rubinstein (1889-1960), quienes buscaban entender las actividades humanas como complejos fenómenos socialmente situados, e ir más allá de los paradigmas del psicoanálisis y de la psicología conductista. Esta se convirtió en una de las mayo...

 

Fictional Western region in Tolkien's legendarium BeleriandJ. R. R. Tolkien's legendarium locationIn-universe informationTypelarge regionLocationsArvernien, Doriath, Falas, Nargothrond, Nevrast, Ossiriand, Taur-im-DuinathPositionnorthwestern Middle-earthPeriodStart of Years of the Trees to end of First Age In J. R. R. Tolkien's fictional legendarium, Beleriand was a region in northwestern Middle-earth during the First Age. Events in Beleriand are described chiefly in his work The Silmarillion...

 

SMP Negeri 4 SemarangInformasiDidirikan1951JenisNegeriAkreditasiANomor Statistik Sekolah201036310004Nomor Pokok Sekolah Nasional20337597Kepala SekolahSjafrudin Djoko Hidajat Nur, M.PdRentang kelasVII sampai IXKurikulumK13AlamatLokasiJl Tambak Dalam 1, Semarang, Jawa Tengah, IndonesiaTel./Faks.(024) 70793227,70793228Situs webhttp://smpn4smg.sch.id/Surelsmpn.4.smg@gmail.comLain-lainLulusanTjahyo Kumolo Awan Setho Ernando Ari SutaryadiMoto SMP Negeri (SMPN) 4 Semarang, merupakan salah ...

Political movement in Greece This article is part of a series onPolitics of Greece Constitution Constitutional history Human rights Executive Head of state President of the Republic (list): Katerina Sakellaropoulou Presidential Departments Government Prime Minister (list): Kyriakos Mitsotakis Cabinet: Kyr. Mitsotakis II Legislature Speaker: Konstantinos Tasoulas Presidium Conference of Presidents Parliamentary committees Constituencies Apportionment Judiciary Supreme courts Special Highest Co...

 

1970 film by Andrew Sinclair The Breaking of BumboOriginal movie posterDirected byAndrew SinclairWritten byAndrew SinclairBased onthe novel by Andrew SinclairProduced byL. Jeffrey SelznickStarringRichard WarwickJoanna LumleyCinematographyIan WilsonEdited byWilly KemplenMusic byBrian GascoigneProductioncompaniesEMI FilmsTimon FilmsDistributed byEMI FilmsRelease date September 1970 (1970-09) (preview only) Running time90 minutesCountryUnited KingdomLanguageEnglishBudget£900,000&#...

 

Charles Michel Abbe d I' Epee Charles Michel Abbe d I'Epee (15 November 1712 – 23 Desember 1789)[1] adalah seorang ahli pendidikan yang berasal dari Prancis yang pernah belajar teologi serta hukum.[1][2] Dia merupakan pelopor pengadaan pendidikan bagi tuna rungu serta merawat mereka, yakni dengan cara meletakkan dasar-dasar sistematika pendidikan tuna rungu di Prancis.[1] Untuk mewujudkan impiannya tersebut, dia membangun sekolah bagi para tuna ...

Lebanon has the highest rate of Christians in the Middle East, where the percentage ranges between 39% and 40.5% of its population. (no official census has been made in Lebanon since 1932). The majority of these consists of the Maronite Church based in Beirut, an Eastern Catholic church in full communion with the Pope and the rest of the Catholic Church. Part of a series on theCatholic Church by country Africa Algeria Angola Benin Botswana Burkina Faso Burundi Cameroon Cape Verde Central Afri...

 

Am Südpark 49 Am Südpark 51 Die Gebäude Am Südpark 49 und 51 sind eine Villengruppe im Kölner Stadtteil Marienburg, die von 1922 bis 1924 errichtet wurde. Sie stehen als Baudenkmal unter Denkmalschutz.[1] Die Villengruppe liegt unmittelbar gegenüber dem Südpark. Inhaltsverzeichnis 1 Geschichte 2 Architektur 3 Literatur 4 Weblinks 5 Einzelnachweise Geschichte Die beiden Villen entstanden für die Bauherren Eduard Meyer (Nr. 49) und Otto Blumenfeld (Nr. 51), beide Mitglied im Vor...

 

Igreja matriz de SoalhãesApresentaçãoTipo igrejapatrimónio culturalEstatuto patrimonial Monumento Nacional (d) (1997)LocalizaçãoLocalização Soalhães PortugalCoordenadas 41° 09′ 38″ N, 8° 05′ 48″ Oeditar - editar código-fonte - editar Wikidata A Igreja de São Martinho de Soalhães é uma igreja situada em São Martinho de Soalhães, freguesia de Soalhães, no município de Marco de Canaveses, em Portugal.[1][2] Em 1997 foi classificada como monumento naciona...

Riemann xi function ξ ( s ) {\displaystyle \xi (s)} in the complex plane. The color of a point s {\displaystyle s} encodes the value of the function. Darker colors denote values closer to zero and hue encodes the value's argument. In mathematics, the Riemann Xi function is a variant of the Riemann zeta function, and is defined so as to have a particularly simple functional equation. The function is named in honour of Bernhard Riemann. Definition Riemann's original lower-case xi-functio...

 

Sebuah rumah di Ascain Ascain (Basque: Azkaine) merupakan sebuah desa kecil di provinsi tradisional Labourd di Basque, sekarang sebuah komune di département Pyrénées-Atlantiques di selatan Prancis. Pranala luar Wikimedia Commons memiliki media mengenai Ascain. AZKAINE in the Bernardo Estornés Lasa - Auñamendi Encyclopedia (Euskomedia Fundazioa) Tersedia dalam Bahasa Spanyol lbsDaftar kotamadya di Labourd (Lapurdi)Ahetze · Ainhoa · Anglet (Anglet) · Arbonn...

 

American painter, photographer, author and inventor This article uses bare URLs, which are uninformative and vulnerable to link rot. Please consider converting them to full citations to ensure the article remains verifiable and maintains a consistent citation style. Several templates and tools are available to assist in formatting, such as reFill (documentation) and Citation bot (documentation). (August 2022) (Learn how and when to remove this template message) Solomon Nunes CarvalhoA portrai...

Inventor of basketball (1861–1939) For the chemical biologist, see James Naismith (chemist). James NaismithNaismith holding a basketball and basketBiographical detailsBorn(1861-11-06)November 6, 1861Almonte, Canada West, Province of CanadaDiedNovember 28, 1939(1939-11-28) (aged 78)Lawrence, Kansas, U.S.Alma materMcGill UniversitySpringfield CollegePresbyterian CollegeCoaching career (HC unless noted)Basketball1898–1907KansasTrack and field1900–1906Kansas Head coaching recordOv...

 

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

 

Not to be confused with Seven Psychopaths. 2017 filmPsychopathsTheatrical release posterDirected byMickey Keating[2]Written byMickey KeatingProduced by Jenn Wexler William Day Frank Mickey Keating Cam McLellan Al Lewison Starring Ashley Bell James Landry Hébert Mark Kassen Angela Trimbur Ivana Shein Jeremy Gardner Samuel D. Zimmerman CinematographyMac FiskenEdited byValerie KrulfeiferProductioncompanies Glass Eye Pix[3] Sorrow Entertainment[3] High Windows Films[3...

Hospital in Indianapolis, Indiana, U.S. Hospital in Indiana, United StatesRiley Hospital for Children at Indiana University HealthIndiana University HealthRiley Hospital for Children Simon Family Tower in 2014.GeographyLocation705 Riley Hospital Drive, Indianapolis, Indiana, United StatesCoordinates39°46′40″N 86°10′47″W / 39.77778°N 86.17972°W / 39.77778; -86.17972OrganizationCare systemNon-profitFundingNon-profit hospitalTypeSpecialistAffiliated university...

 

Toilet that is easily moved around A portable urine-diverting dry toilet as marketed by SOIL in Haiti under the name EkoLakay A portable or mobile toilet (colloquial terms: thunderbox, porta-john or porta-potty) is any type of toilet that can be moved around, some by one person, some by mechanical equipment such as a truck and crane. Most types do not require any pre-existing services or infrastructure, such as sewerage, but are completely self-contained. The portable toilet is used in a vari...

 

Teatro de las grandezas de la Villa de Madrid, Corte de los Reyes Católicos de España; por Gil Gonçalez Dauila de Gil González Dávila Vista de la portada, obra de Juan SchorquensEditor(es) Thomas IunctiIdioma Español Ciudad Madrid Fecha de publicación 1623 [editar datos en Wikidata] Teatro de las grandezas de la villa de Madrid es una obra sobre la historia de Madrid y la corte española escrita por Gil González Dávila.[1]​ Historia El libro fue en parte patrocin...

Court building in Melbourne, Australia Not to be confused with Magistrates' Court of Victoria. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Melbourne Magistrates' Court – news · newspapers · books · scholar · JSTOR (July 2013) (Learn how and when to remove this template message) The Melbourne Magistrates'...

 

American writer and governmental official Bing WestWest at CPAC in 2011Assistant Secretary of Defense for International Security AffairsIn officeApril 4, 1981 – April 1, 1983PresidentRonald ReaganPreceded byDavid E. McGiffertSucceeded byRichard Armitage Personal detailsBornFrancis J. West Jr. (1940-05-02) May 2, 1940 (age 83)Boston, Massachusetts, U.S.SpouseElizabethChildren4 (including Owen)ResidenceNewport, Rhode IslandEducationGeorgetown University (B.A.)Princeton Universit...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!