Somogyjád

Somogyjád
Somogyjád
Blason de Somogyjád
Blason de Somogyjád
(Voir carte Hongrie administrative)
Somogyjád
(Voir carte Hongrie topographique)
Somogyjád
Administration
Pays Drapeau de la Hongrie Hongrie
Comitat
(megye)
Somogy
(Transdanubie méridionale)
District
(járás)
Kaposvár
Rang Commune
Bourgmestre
(polgármester)
Mandat
Lőrinczné Kiss Ilona Margit (indépendant)
(2014-2019)
Code postal 7443
Indicatif téléphonique (+36) 82
Démographie
Population 1 451 hab. ()
Densité 58 hab./km2
Géographie
Coordonnées 46° 29′ 21″ nord, 17° 42′ 43″ est
Superficie 2 506 ha = 25,06 km2
Divers
Collectivités des minorités Tsiganes (1er janv. 2011)
Identités ethniques
(nemzetiségi kötődés)
Hongrois 95,5 %, Tsiganes 2,7 %, Croates 0,4 % (2001)
Religions catholiques 66,3 %, grecs-catholiques 0,2 %, réformés 12,7 %, évangéliques 1,1 %, autres confessions 0,7 %, sans religion 7,3 % (2001)
Liens
Site web somogyjad.huVoir et modifier les données sur Wikidata
Sources
Office central de statistiques (KSH)
Élections municipales 2014

Somogyjád est un village et une commune du comitat de Somogy en Hongrie.

Géographie

Histoire

Read other articles:

Dewan Sumber Daya Air NasionalLogo Dewan Sumber Daya Air NasionalGambaran UmumSingkatanDSDANDasar hukum pendirianPeraturan Presiden Nomor 53 Tahun 2022 Tentang Dewan Sumber Daya Air NasionalSifatBerada di bawah dan bertanggung jawab kepada PresidenStrukturKetuaMenteri Koordinator Bidang PerekonomianWakil KetuaMenteri Koordinator Bidang KemaritimanKetua HarianMenteri Pekerjaan Umum dan Perumahan RakyatKantor pusatGd. Ditjen SDA, Jl. Pattimura No. 20 Kebayoran Baru Jakarta Selatan DKI Jakarta 1...

 

Untuk kegunaan lain, lihat Bawang Putih Berkulit Merah. Bawang Putih Bawang MerahGenre Drama Roman Komedi PembuatMD EntertainmentDitulis olehDono IndartoSkenarioDono IndartoSutradara Mukta Dhond Ferial Pemeran Afifa Syahira Bernadette Audrey Eza Gionino Aiman Ricky Dwi Andhika Cindy Fatika Sari Teuku Ryan Marthino Lio Fathya Artha Utami Beauty Lupia Emanuela Viska W Arieska Kartika Putri Zaskia Sungkar Lagu pembukaSlow Down Baby — SHELagu penutupSlow Down Baby — SHEPenata musikIwang...

 

Esta página cita fontes, mas que não cobrem todo o conteúdo. Ajude a inserir referências. Conteúdo não verificável pode ser removido.—Encontre fontes: ABW  • CAPES  • Google (N • L • A) (Agosto de 2022) Lysychansk   Cidade   Símbolos Bandeira Brasão de armas Localização LysychanskLocalização de Lysychansk na Ucrânia Coordenadas 48° 55' N 38° 24' E País Ucrânia (de jure)República Popu...

Toshirō Mayuzumi Toshirō Mayuzumi (1954)Información personalNombre nativo 黛 敏郎 Mayuzumi ToshirōNacimiento 20 de febrero de 1929Yokohama, región de Kantō (Japón)Fallecimiento 10 de abril de 1997Kawasaki, Kanagawa (Japón)Causa de muerte Insuficiencia hepáticaNacionalidad JaponesaEducaciónEducado en Universidad Nacional de Bellas Artes y Música de TokioConservatorio de ParísInformación profesionalOcupación CompositorMúsicoAños activo 1946-1997Movimiento Música electrónica...

 

Ця стаття є частиною Проєкту:Населені пункти України (рівень: невідомий) Портал «Україна»Мета проєкту — покращувати усі статті, присвячені населеним пунктам та адміністративно-територіальним одиницям України. Ви можете покращити цю статтю, відредагувавши її, а на стор...

 

Australian rules football club For the Eastern Football League team, see Norwood Football Club (Victoria). NorwoodNamesFull nameNorwood Football ClubNickname(s)RedlegsMottoFortis in Procella (Strength in Adversity)2022 seasonAfter finals1stHome-and-away season3rdLeading goalkickerConnor McLean (34)Best and fairestHarry BoydClub detailsFounded1878; 145 years ago (1878)ColoursNavy blue, red   CompetitionSouth Australian National Football LeaguePremiershipsSANFL (31):...

American politician Joel T. HeadleyBornDecember 30th, 1814Walton, New YorkDiedJanuary 16th, 1897 (aged 82)Newburgh, New YorkNationalityAmericanEducationUnion College, Auburn Theological SeminaryOccupation(s)Historian, writer, politician, adventurerYears active1844 - 1890Political partyAmerican PartySpouseAnna Allston Russel (m. 1850)ChildrenRussel, Lucy, Joel Tyler Joel Tyler Headley (December 30, 1813 – January 16, 1897) was an American clergyman, historian, author, newspaper edit...

 

Visual depiction of a fly in paintings This article is about painted representations of flies in artworks. For the fly species formerly called Musca picta, see Delphinia picta. Petrus Christus's Portrait of a Carthusian has a musca depicta perched on the trompe-l'œil frame. Musca depicta (painted fly in Latin; plural: muscae depictae) is a depiction of a fly as a conspicuous element of various paintings.[1] The feature was widespread in 15th- and 16th-century European paintings, and ...

 

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

Short story by Rudyard KiplingThe Story of the GadsbysShort story by Rudyard KiplingFrontispiece The Story of the Gadsbys 1899Publication The Story of the Gadsbys is a story by Rudyard Kipling.[1] It was originally published as no. 2 of the Indian Railway Library in 1888. The Story of the Gadsbys is written in dramatic form, consisting of eight short scenes (listed below). This short pamphlet, of 100 pages, was later collected in book form as the second part of Soldiers Three. Poo...

 

This article is about the Cuban province. For other uses, see Sancti Spiritus (disambiguation). Province of Cuba Province of CubaSanctí SpiritusProvince of CubaProvincia de Sancti Spiritus (Spanish) Province of Sancti Spiritus (English)CountryCubaCapitalSancti SpíritusArea[1] • Total6,779.81 km2 (2,617.70 sq mi)Population (2015)[1] • Total617,235 • Density91/km2 (240/sq mi)Time zoneUTC-5 (EST)Area code+53-41HDI (20...

 

Evangelical Lutheran Church in CameroonLogo of the EELCClassificationProtestantOrientationLutheranLeaderRev. Dr. Ruben NGOZOAssociationsLWFRegionCameroonOrigin1965 NgaoundéréBranched fromEvangelical Lutheran Church of Cameroon and the Central African RepublicCongregations1,300Members253,000Ministers147Secondary schoolsCollège Protestant de Ngaoundéré ( Colprot)Official websitehttp://www.eelc-adc.org/eelc/ The Evangelical Lutheran Church of Cameroon (EELC) (French: L’Eglise Evangélique...

National governing body of cycle racing in Denmark Not to be confused with Danish Cyclists' Federation. The Danish Cycling Federation or DCU (in Danish: Danmarks Cykle Union) is the national governing body of cycle racing in Denmark. The DCU is a member of the UCI and the UEC. See also Cycling Embassy of Denmark Cycling in Denmark Cycling in Copenhagen Danish Cyclists Federation Outline of cycling External links Danish Cycling Federation official website vteNational members of the Union Cycli...

 

Українська миротворча місія в Ліберії (2003-2018) Топографічна карта ЛіберіїТопографічна карта Ліберії Дата: 2003 - 2018 Місце: Ліберія Результат: Сторони 56-й окремий вертолітний загін ЗСУ Командувачі полковник Когут А. М. Військові сили 275 солдатів і офіцерів Втрати 5[1] Украї...

 

PA-1 Role FighterType of aircraft National origin United States Manufacturer Loening Aeronautical Engineering Designer Leroy Grumman, Leon Swirbul, William Schwendler First flight March 1922[1] Number built 1 The Loening PA-1 (Pursuit-Air cooled) was an American fighter aircraft prototype built by Loening Aeronautical Engineering. Development The PA-1 was a single-seat biplane with N-struts powered by a Wright R-1454 radial engine, an all-wood fuselage and wings with fabric coverings....

For demographics of Yugoslavia between 1945 and 1992, see Demographics of the Socialist Federal Republic of Yugoslavia. The Kingdom of Yugoslavia existed between its creation in 1918 until its occupation and partition by Axis powers in World War II. The first census in 1921 enumerated 11,984,911, while the second and last census in 1931 enumerated 13,934,038 people. While both censuses grouped ethnic groups according to their mother tongue, the latter did not record separate constituent natio...

 

1639 map of New Amsterdam Harrisse/LOC copy of the Manatus Map of 1639 Villa di Castello copy of the map. The Manatus Map is a 1639 pictorial map of the New York–New Jersey Harbor Estuary at the time the area was part of the colony of New Netherland. Entitled Manatvs gelegen op de Noot Riuier (Manhattan situated on the North River) it shows the geographic features of the region, as well as New Amsterdam and other New Netherland settlements. The map was drafted when Willem Kieft was Director...

 

1977 film directed by John Flynn Rolling ThunderTheatrical release posterDirected byJohn FlynnScreenplay by Paul Schrader Heywood Gould Story byPaul SchraderProduced byNorman T. HermanStarring William Devane Tommy Lee Jones Linda Haynes CinematographyJordan CronenwethEdited byFrank P. KellerMusic byBarry De VorzonProductioncompanies Lawrence Gordon Productions TBC Film Distributed byAmerican International PicturesRelease date October 7, 1977 (1977-10-07) (Los Angeles) [...

2002 studio album by GravesWeb of DharmaStudio album by GravesReleasedMay 31, 2002RecordedNovember 2–5, 2001GenreHorror punk, pop punkLabelGDU RecordsProducerGraves (Dr. Chud) Web of Dharma is a 2002 album by American pop punk/horror punk band Graves,[1][2] featuring ex-Misfits singer Michale Graves and drummer Dr. Chud.[1][3] Demos and recording Demos for Web of Dharma were recorded in November 2001. These recordings were produced by Ron Gouldie at J...

 

Shiroishi 白石市Kota Bendera[[Shiroishi, Miyagi|]]Location of Shiroishi in Miyagi PrefectureNegara JepangWilayahTōhokuPrefekturMiyagiPemerintahan • WalikotaYūichi YamadaLuas • Total286,48 km2 (11,061 sq mi)Populasi (Oktober 1, 2019) • Total33.380 • Kepadatan117/km2 (300/sq mi)Zona waktuUTC+9 (Japan Standard Time)Simbol kota • PohonFagus crenata• BungaKerria japonica• BurungHorornis diphoneNomor ...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!