within genetic material (DNA or RNA sequences of nucleotide triplets or codons) into proteins. Translation is accomplished by the ribosome, which links...

A codon table can be used to translate a genetic code into a sequence of amino acids. The standard genetic code is traditionally represented as an RNA...

In molecular biology, a stop codon (or termination codon) is a codon (nucleotide triplet within messenger RNA) that signals the termination of the translation...

A codon is a three-base sequence of DNA that encodes a single amino acid in the genetic code Codon may also refer to: Codon (plant), a genus of plants...

Degeneracy or redundancy of codons is the redundancy of the genetic code, exhibited as the multiplicity of three-base pair codon combinations that specify...

The start codon is the first codon of a messenger RNA (mRNA) transcript translated by a ribosome. The start codon always codes for methionine in eukaryotes...

Codon usage bias refers to differences in the frequency of occurrence of synonymous codons in coding DNA. A codon is a series of three nucleotides (a...

point mutation in a sequence of DNA that results in a nonsense codon, or a premature stop codon in the transcribed mRNA, and leads to a truncated, incomplete...

The Codon Adaptation Index (CAI) is the most widespread technique for analyzing codon usage bias. As opposed to other measures of codon usage bias, such...

frames are defined as spans of DNA sequence between the start and stop codons. Usually, this is considered within a studied region of a prokaryotic DNA...

Codon is a genus of planthoppers in the family Fulgoridae, subfamily Stronglyodematinae. Species occur in South Africa. Codon adrastus Fennah, 1967 Codon...

Codon royenii is a species of flowering plant in the genus Codon. It is native to Namibia and the Northern Cape Province of South Africa. It is also known...

tRNA specifies which three-nucleotide codon from the genetic code corresponds to which amino acid. Each mRNA codon is recognized by a particular type of...

corresponding to the mRNA codon, in the case of the start codon, this is the amino acid methionine. The next codon (adjacent to the start codon) is then bound by...

Codon schenckii is a species of flowering plant in the genus Codon. It is native to Namibia and the Northern Cape Province of South Africa. It is also...

nature of gene expression by codons, the insertion or deletion can change the reading frame (the grouping of the codons), resulting in a completely different...

genetic code, there are 43 = 64 possible codons (three-nucleotide sequences). For translation, each of these codons requires a tRNA molecule with an anticodon...

is an artificially modified genetic code in which one or more specific codons have been re-allocated to encode an amino acid that is not among the 22...

binding of complementary transfer RNA (tRNA) anticodon sequences to mRNA codons. The tRNAs carry specific amino acids that are chained together into a polypeptide...

messenger RNA (mRNA). During translation, the ribosome decodes successive codons in an mRNA molecule and, with the aid of transfer RNA (tRNA), links amino...

Effective number of codons (abbreviated as ENC or Nc) is a measure to study the state of codon usage biases in genes and genomes. The way that ENC is computed...

nearby UGA codon as selenocysteine (UGA is normally a stop codon). In some methanogenic prokaryotes, the UAG codon (normally a stop codon) can also be...

encoded by the stop codons—TGA and TAG respectively.) The mismatch between the number of codons and amino acids allows several codons to code for a single...

Typically codons, sets of three mRNA nucleotides, correspond to one specific amino acid. Codon reassignment is the exception to this rule. When a codon is reassigned...

UGA represents an additional glycine codon and does not code for termination. A survey of many genomes with the codon assignment software Codetta, analyzed...

both carry a mutation at codon 178 of the prion protein gene. FFI is also invariably linked to the presence of the methionine codon at position 129 of the...

amino acids are coded for by more than one three-base-pair codon; since some of the codons for a given amino acid differ by just one base pair from others...

are arranged into codons consisting of three ribonucleotides each. Each codon codes for a specific amino acid, except the stop codons, which terminate...

sequences as codons, groups of three nucleotides. Each codon represents a single amino acid in a protein chain. However, there are more codons (64) than...

The Koudounia (Greek: κουδούνια), are bell-like percussion instruments. Most often, they are made from copper and upon playing (that is, hitting them with...

is the initiation codon encoding a methionine amino acid at the N-terminus of the protein. (Rarely, GUG is used as an initiation codon, but methionine is...

permit short (< 600bp) open reading frames (ORFs) due to frequent stop codons. The short ORFs could have contained the short protein-coding exons observed...

Codon is a small genus of plants from South Africa in the family Codonaceae in the order Boraginales. It is the only genus in the family, and comprises...

possible codons in the genetic code are stop codons, one would expect a stop codon approximately every 20–25 codons, or 60–75 base pairs, in a random sequence...

Since 1970 it has been organising different activities for its members. CODON is the study Association for all Biotechnology (BBT and MBT), Bioinformatics...

of alternative codons in pterobranchs and comparison with the standard genetic code Genetic code Translation table DNA codon RNA codon Translation with...

was first isolated in 1921 by John Howard Mueller. It is encoded by the codon AUG. It was named by Satoru Odake in 1925, as an abbreviation of its structural...

Allozyme Alternative splicing Altruism Alu family Alzheimer's disease Amber codon Ames test Amino acid Amino acid sequence Amino acids Amniocentesis Amorph...

the rare codon can affect the timing of translation, and in turn the co-translational folding of the protein. This is reflected in the codon usage bias...

expression by eliminating mRNA transcripts that contain premature stop codons. Translation of these aberrant mRNAs could, in some cases, lead to deleterious...

compositionally driven, synonymous codon-usage bias affects the nucleotide topology. As substitutions between serine codon families can proceed through threonine...

translation. Each group of three nucleotides in the sequence, called a codon, corresponds either to one of the twenty possible amino acids in a protein...

variable codons, is a technique in computational phylogenetics that allows the hypothesized rate of molecular evolution at individual codons in a set...

messenger RNA. It is generally located around 8 bases upstream of the start codon AUG. The RNA sequence helps recruit the ribosome to the messenger RNA (mRNA)...

ERF1 gene. In Eukaryotes, eRF1 is an essential protein involved in stop codon recognition in translation, termination of translation, and nonsense mediated...

P102L mutation, which causes a substitution of proline to a leucine in codon 102, has been found in the prion protein gene (PRNP, on chromosome 20) of...

2,501,097 bp. Micrococcus luteus was one of the early examples of novel codon usage, which led to the conclusion that the genetic code is not static,...

vertebrata. AGA and AGG were thought to have become mitochondrial stop codons early in vertebrate evolution. However, at least in humans it has now been...

mutagenesis technique used in protein engineering, in which a single codon or set of codons is substituted with all possible amino acids at the position. There...

termination codon (a stop was lost), resulting in abnormal extension of a protein's carboxyl terminus. Start-gain creates an AUG start codon upstream of...

definitive evidence in favor of universal common descent. The way that codons (DNA triplets) are mapped to amino acids seems to be strongly optimised...

respect to codon usage, the ambush hypothesis theorizes that there is a positive correlation between the use of a codon and the amount a codon contributes...

The encoding of proteins is done in groups of three, known as codons. The standard codon table applies for humans and mammals, but some other lifeforms...

27 and 28, is remarkable in that every one of the 64 possible codons can be a sense codon.    AAs = FFLLSSSSYYEECCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG...

conserved bases around the initiation codon from all human mRNAs (Kozak consensus sequence). Note that the initiation codon is not drawn to scale, otherwise...

variations in alternative start codons. A Possible start codons in NCBI table 1. AUG is most common. The two other start codons listed by table 1 (GUG and...

which can bind with a termination codon on mRNA; b) a mutation on ribosomes decreasing the effect of a termination codon. It is believed that nonsense suppressors...

with slight variations, notably the use of UGA as a tryptophan codon rather than a stop codon.    AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG...

The ciliate macronuclear code has not been determined completely. The codon UAA is known to code for Gln only in the Oxytrichidae.    AAs =...

CodonCode Aligner is a commercial application for DNA sequence assembly, sequence alignment, and editing on Mac OS X and Windows. Features include chromatogram...

of a messenger RNA (mRNA) that is directly upstream from the initiation codon. This region is important for the regulation of translation of a transcript...

a codon substitution model (a codon is three bases and codes for one amino acid in a protein). There are 4 3 = 64 {\displaystyle 4^{3}=64} codons, resulting...

DNA or RNA into protein; any continuous stretch of codons that contains a start codon and a stop codon. operator A regulatory sequence within an operon...

redundancy of the 3 codons that encode a "stop" signal. If one of these can be substituted by another stop codon, then that codon can in principle be...

scanning and selection of the start codons. This can create changes in the selection of the factors, binding to different codons. Another important eukaryotic...

familial insomnia is thought to be the result of a point mutation in PRNP at codon 178, which corroborates PrP's involvement in sleep-wake cycles. In addition...

phages. The Rho-dependent terminator occurs downstream of translational stop codons and consists of an unstructured, cytosine-rich sequence on the mRNA known...

the IMA symbol for the pyroxene mineral Augite AUG, the most common start codon, often encoding the amino acid methionine Augusta Railroad, defunct Arkansas...

in a stop codon after 21 codons 0.0 Male C to A substitution in intron V, at 3' splicing acceptor site before exon VI Premature stop codon - Male Insertion...

Variation in translation of the mitochondrial genetic code occurs when DNA codons result in non-standard amino acids has been identified in invertebrates...

example, the ribosome has to select the correct tRNA that matches the mRNA codon among many structurally similar tRNAs. If the recognizer and its correct...

which lack part of the TAD and DBD. Alternative translation initiation at codons 40 or 160 results in ∆40p53 and ∆160p53 isoforms, respectively. p53 regulates...

influenced by a common polymorphism at codon 129 of the PRNP gene (methionine/valine). Notably, individuals homozygous at codon 129 are over-represented in sporadic...

28 and 31, is remarkable in that every one of the 64 possible codons can be a sense codon. Translation termination probably relies on context, specifically...

Globe de Paris G2G Racing, an American stock car racing team GTG, a codon in the DNA codon table for the amino acid valine G2G, government-to-government, as...

notable differences" For example, Codon uses 64-bit machine integers for speed, not arbitrarily as with Python; Codon developers claim that speedups over...

series of triplets (codons) of four possible nucleotides can be translated into one of twenty possible amino acids. A sequence of codons results in a corresponding...

numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors. With the protein size correction, this codon is...

protein that functions as a releasing factor that recognizes termination codons and releases mitochondrial ribosomes from the synthesized protein (summary...

5'UTR to locate a start codon to commence elongation. Sometimes, the scanning ribosome bypasses the initial AUG start codon and begins translation at...

Pyrrolysine (symbol Pyl or O), encoded by the "amber" stop codon UAG, is a proteinogenic amino acid that is used in some methanogenic archaea and in bacteria...

translation initiated at the usual AUG or a similar (CUG, GUG, UUG, or ACG) start codon. This results in expression of a pathogenic protein encoded by one particular...

same time as, or shortly after, another drug Concomitantly variable codon, a codon in a computational phylogenetic model in which the hypothesized rate...

stabilize the formation of ribosomal preinitiation complexes around the start codon and are an important input for post-transcription gene regulation. Several...

Sharp, Paul M.; Li, Wen-Hsiung (1987). "The codon adaptation index-a measure of directional synonymous codon usage bias, and its potential applications"...

experiment). This greatly sped up the assignment of three-base codons to amino acids so that 50 codons were identified in this way. Khorana's experiments confirmed...

identified an association between susceptibility to sCJD and a polymorphism at codon 129 in the PRNP gene, which encodes the prion protein (PrP). A homozygous...

phenylalanine transfer RNA that stabilizes interactions between the codons and anti-codons during protein synthesis. Ensuring accurate synthesis of protein...

sequence. It is caused by a nonsynonymous missense mutation which changes the codon sequence to code for a different amino acid than the original sequence....

Protein signal which causes the release of transcribed RNA at a stop codon...

termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein...

the tRNA which is linked to the growing polypeptide chain. When a stop codon is reached, the peptidyl-tRNA bond of the tRNA located in the P-site is...

serotonin, the hormone melatonin, and vitamin B3 (niacin). It is encoded by the codon UGG. Like other amino acids, tryptophan is a zwitterion at physiological...

27 and 31, is remarkable in that every one of the 64 possible codons can be a sense codon. Experimental evidence suggests that translation termination...

addition of a TAG stop codon in the middle of gIII. Synthetases that aminoacylate the TAG codon's suppressor tRNA prevents stop codon activity, allowing for...

non-overlapping 3-mers are called codons. While each codon only maps to one amino acid, each amino acid can be represented by multiple codons. Thus, the same amino...

amino acids making up a protein strand. Each group of three bases, called a codon, corresponds to a single amino acid, and there is a specific genetic code...

would be enough to define all 20 amino acids. This concept is the basis of "codons", and set an upper and lower limit on their size. Gamow had simply estimated...

Coudons (French: [kudɔ̃] ; Occitan: Codons) is a commune in the Aude department in southern France. Communes of the Aude department "Répertoire national...

by mRNA binding, and starts codon-P-site interaction. IF2 enters with the initiator tRNA and places it on the start codon. GTP hydrolysis by IF2 releases...

or "shunt over", parts of the 5' untranslated region to reach the start codon. However, a benefit of ribosomal shunting is that it can translate backwards...

(December 2018). Parkinson's Disease: Pathogenesis and Clinical Aspects. Codon Publications. ISBN 978-0-9944-3816-4. Greenland JC, Barker RA (2018). "The...

for the termination of translation by recognizing the termination codon or stop codon in an mRNA sequence. They are named so because they release new peptides...

that base pairs with specific nucleotide triplets on the mRNA called codons; codons encode a specific amino acid. This interaction is possible thanks to...

suppressor mutations for tRNA. The Garen lab also showed that certain triplet codons (5'-UAG, 5'-UAA, and 5'-UGA) failed to bind amino acids. Thus, the Garen...

hard to characterize morphologically if it includes the genera Codon and Wellstedia. Codon was long regarded as an unusual member of Hydrophyllaceae, but...

premature stop codons (an effect referred to as "read-through") by promoting insertion of certain near-cognate tRNA at the site of nonsense codons with no apparent...

Missense mRNA is a messenger RNA bearing one or more mutated codons that yield polypeptides with an amino acid sequence different from the wild-type or...

amino acid, it is more hydrophilic than phenylalanine. It is encoded by the codons UAC and UAU in messenger RNA. The one-letter symbol Y was assigned to tyrosine...

polypeptide chain when the ribosome encounters a stop codon. While eRF1 recognizes stop codons, eRF3 facilitates the release of the polypeptide chain...

Holley and Marshall Warren Nirenberg after DNA was understood to contain codons. The Human Genome Project was launched in 1990 to map the human genome....

other. Tropane alkaloid biosynthesis is another avenue of defense with codons positively selected and expanded in the Datura branch. It is aided by the...

increases, and glutamine must be obtained from the diet. It is encoded by the codons CAA and CAG. It is named after glutamic acid, which in turn is named after...

codons (phase 0 introns), between the first and second nucleotide of a codon (phase 1 introns), or between the second and third nucleotide of a codon...

and the biological pigment melanin. It is encoded by the messenger RNA codons UUU and UUC. The one-letter symbol F was assigned to phenylalanine for its...

longer-term studies to be essential for adults also. It is encoded by the codons CAU and CAC. Histidine was first isolated by Albrecht Kossel and Sven Gustaf...

into some proteins at a UGA codon, which is normally a stop codon. Pyrrolysine is incorporated into some proteins at a UAG codon. For instance, in some methanogens...

RECODE is a database of "programmed" frameshifts, bypassing and codon redefinition used for gene expression. Translational frameshift Baranov, P V; Gurvich...

N-terminus toward its C-terminus. For example, in a typical gene a start codon (5′-ATG-3′) is a DNA sequence within the sense strand. Transcription begins...

for premature stop codons. The assembly of this complex is triggered by premature translation termination. If a premature stop codon is detected then the...

specific tRNA molecules could recognize multiple codons. The area of the tRNA that recognizes the codon called the anticodon is able to bind multiple interchangeable...

methods in a user interface Codon redundancy, the redundancy of the genetic code exhibited as the multiplicity of three-codon combinations Cytokine redundancy...

Typed Set Theory; see New Foundations Phenylalanine, an amino acid with the codon TTT Tilt table test, a medical test for dysautonomia and/or syncope The...

codes were discovered in bacterial genomes by Shulgina and Eddy using their codon assignment software Codetta, and validated by analysis of tRNA anticodons...

particular genetic makeup; those who were methionine-homozygous at the PRNP codon 129 methionine/valine polymorphism. Studies of similar diseases in other...

(Trp, W), Tyrosine (Tyr, Y), Valine (Val, V) This code uses the initiation codons AUG, GUG and UUG. Pachysolen tannophilus List of genetic codes This article...

of Health (NIH). The experiment deciphered the first of the 64 triplet codons in the genetic code by using nucleic acid homopolymers to translate specific...

After Health Care Vote – CBS News". CBS News. Retrieved October 29, 2023. Codon, Stephanie (March 22, 2010). ""Fire Nancy Pelosi" Becomes GOP Slogan After...

occurs in all transfer RNAs (tRNAs) that read codons starting with C except in those tRNAs that read CAN codons. m1G can help prevent errors in protein synthesis...

to higher G+C content. This has been pointed to the fact that the stop codon has a bias towards A and T nucleotides, and, thus, the shorter the sequence...

as codons, from one end of the mRNA to the other (from the 5' to the 3' end) starting with the amino acid methionine as the start (initiation) codon AUG...

cytosine-guanine-guanine (CGG) codons in the virus' RNA, more precisely in the crucial furin cleavage site. The CGG codon is one of several codons that translates into...

start codon within the large A genes. Only genes A* and K are thought to be non-essential, although there is some doubt about A* because its start codon could...

Isoleucine J Leucine (L) or Isoleucine (I) K Lysine L Leucine M Methionine/Start codon N Asparagine O Pyrrolysine (rare) P Proline Q Glutamine R Arginine S Serine...

each of 26 codons, these being chosen out of the total of 64. These DNA codons would then be transcribed into the complementary RNA codons, which would...

displayed in a thicker way on a graphical representation (e.g.: the start codon of a gene) No 8 thickEnd End coordinates from which the annotation is no...

Cahn-Ingold-Prelog sequence rules. Codons can also be expressed by: CGN, AGR. Codons can also be expressed by: CUN, UUR. Codons can also be expressed by: CTN...

(Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing...

Anti-codon recognition leaves the "wobble" base free to accommodate certain non-Watson/Crick basepairs, thus providing an atomic description of both codon:anti-codon...

transient component of the ectoderm Effective number of codons, a measure to study the state of codon usage biases in genes (-NC) Isocyanide, an organic functional...

nature of gene expression by codons, the insertion or deletion can disrupt the reading frame, or the grouping of the codons, resulting in a completely different...

identified to have a 4 base pair deletion. This induces a premature stop codon in the receptor that is absent in all straight haired cats analyzed. LPAR6...

Translation CRACDL Part 1. The upstream stop codon is orange, the exon boundaries are highlighted blue, the start codon is green, the predicted nuclear location...

syndrome differs as it was more specifically linked to a mutation on the R702 codon on the MYH9 gene. Diseases with mutations on the MYH9 gene also include...

AUU may refer to: an abbreviation for Adelaide University Union AUU, a codon for the amino acid isoleucine Aurukun Airport, IATA airport code "AUU" This...

terminators. In the context of translation, a termination signal is the stop codon on the mRNA that elicits the release of the growing peptide from the ribosome...

nt NP_001287948.1 264 aa Alternate exons 1 and 2, uses alternate start codon 7 isoform d NM_001301021.2 3166 nt NP_001287950.1 263 aa Alternate exons...

forum which provides free help and support on all consumer issues CAG, a codon that encodes the α-amino acid glutamine CAG, ISO provincial code for the...

"Consensus" is defined as protein-coding regions that agree at the start codon, stop codon, and splice junctions, and for which the prediction meets quality...

translation initiation codon to produce the normal 50-kDa ACAT1 protein but used an alternative translation initiation codon, GGC, to produce the novel...

from the symmetrical distribution of the codons. This symmetry allows for arythmic exploration of the codon distribution. In 2013, shCherbak and Makukov...

lumacaftor had no medical use on its own. Ataluren, targeting premature stop codons Kuk K, Taylor-Cousar JL (December 2015). "Lumacaftor and ivacaftor in the...

E, Mueller S (June 2008). "Virus attenuation by genome-scale changes in codon pair bias". Science. 320 (5884): 1784–87. Bibcode:2008Sci...320.1784C. doi:10...

Poison exons (PEs); also called premature termination codon (PTC) exons or nonsense-mediated decay (NMD) exons] are a class of cassette exons that contain...

three-letter 'words' called codons formed from a sequence of three nucleotides (e.g., ACT, CAG, TTT). In transcription, the codons of a gene are copied into...

shortened to TAG Tumor-associated glycoprotein, a type of protein TAG, a stop codon Tag (game), a playground game Tag (horse), an 18th-century thoroughbred...

non-essential in humans, meaning the body can synthesize it. It is encoded by the codons AAU and AAC. The one-letter symbol N for asparagine was assigned arbitrarily...

open reading frames, ORF1 and ORF2. They initiate at two different AUG codons. Additional ORFs can be formed as well. These ORFs may overlap partially...

circumstances, making it a nonessential amino acid. It is encoded by the codons UCU, UCC, UCA, UCG, AGU and AGC. This compound is one of the proteinogenic...

in the Royal Canadian Navy Leucine, represented in genetic codon code; see DNA and RNA codon tables You the Rock, Japanese hip-hop musician also known...

complex in search of the translation initiation start codon. Accurate identification of the start codon is very important, as other translation start sites...

an enzyme Galactoside acetyltransferase, an enzyme Aspartic acid (codon: GAT), an amino acid Khat (or gat), a stimulant plant Gat air pistol, a...

replication-deficient chimpanzee adenovirus ChAdOx1, containing the full‐length codon‐optimised coding sequence of SARS-CoV-2 spike protein along with a tissue...

Valine (Val, V). The remaining CGN codons are rare in Saccharomyces cerevisiae and absent in Candida glabrata. The AUA codon is common in the gene var1 coding...

Nobel Prize in Physiology or Medicine (1968) for the elucidation of how codons are utilized for protein synthesis Antonia Novello – first woman and first...

primarily targeted on the control of ribosome recruitment on the initiation codon, but can also involve modulation of peptide elongation, termination of protein...

alternative mitochondrial codes. Further, the AUA, AUC, and AUU codons are all allowable start codons. Some of these differences should be regarded as pseudo-changes...

code. Instead, it is encoded in a special way by a UGA codon, which is normally the "opal" stop codon. Such a mechanism is called translational recoding and...

are found in the 6 TEDC2 isoforms. Green = contains a start codon. Red = contains a stop codon. Check = Exon included in the final mRNA transcript. -- =...

and its carboxyl group deprotonated (as −CO−2). Alanine is encoded by all codons starting with GC (GCU, GCC, GCA, and GCG). The L-isomer of alanine (left-handed)...

mRNA sequence contains codons: 3 nucleotide long segments that code for a specific amino acid. Ribosomes translate the codons to their respective amino...

circuits related to limb movement and motion, causes a "premature 'stop codon'" in horses with lateral ambling gaits. Such breeds include the following:...

Kozak, M (1987). "At least six nucleotides preceding the AUG initiator codon enhance translation in mammalian cells". J Mol Biol. 196 (4): 947–50. doi:10...

64 codons is circular with an asymmetric distribution of codons that leads to a clear segregation between GC-rich 4-codon boxes and AU-rich 2:2-codon and...

of Archean age Transmit/receive transition gap in communications TTG, a codon for the amino acid Leucine TTG Studios, Los Angeles, US Travel Trade Gazette...

directly to exon 13 (instead of exon 12). This creates a premature stop codon (amino acid position 378) in the gene's protein product, rendering it nonfunctional...

series of three base pair codons which code for individual amino acids; this "triplet-code" is summarized in DNA and RNA codon tables. The experiment also...

South Carolina, US Campaign for Good Governance, in Sierra Leone CGG, a codon for the amino acid arginine CGG repeats, a trinucleotide repeat disorder;...

(although with thymine replaced by uracil). It is this strand which contains codons, while the non-coding strand contains anticodons. During transcription,...

Arg, Thr, Ser; conservation is observed in these 5 codons whereas mutating the upstream codons do not alter the operon expression. If the ribosome attempts...

from the non-essential amino acid L-glutamate. It is encoded by all the codons starting with CC (CCU, CCC, CCA, and CCG). Proline is the only proteinogenic...

products, soy products, and beans and other legumes. It is encoded by the codons UUA, UUG, CUU, CUC, CUA, and CUG. Leucine is named after the Greek word...

language (ISO 639-3 code: ggg), a Rajasthani language of Pakistan GGG, a codon for the amino acid glycine 3G (disambiguation) G3 (disambiguation) This...

comprehensive approach is site saturation mutagenesis where one codon or a set of codons may be substituted with all possible amino acids at the specific...

mouse model was described in 1990 and carries an Apc allele with a stop codon at position 850. Heterozygosity for this mutation results in a fully penetrant...

similar to the low GC-content of the base composition translational stop codons like TAG, TAA, and TGA. GC-rich areas are also where the ratio point mutation...

discharge date Stop-loss variant, a genetic variant that causes loss of a stop codon Stop-Loss (film), a 2008 film about soldiers subject to the stop-loss policy...

phylogenetic analysis in 2008, and all members possess a unique single codon deletion in the phosducin (PDC) gene. The phyllodactylid genus Bogertia...

nucleic acid (CeNA). The incorporation of XNA in a plasmid, involving 3 HNA codons, has been accomplished already in 2003. This XNA is used in vivo (E coli)...

ribosome to overcome the stop codon and produce a full-length CFTR protein. About 10% of CF results from a premature stop codon in the DNA, leading to early...

required for catalytic activity. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenocysteine-containing...

example when reaching the end of a messenger RNA which has lost its stop codon. The tmRNA is remarkably versatile: it recycles the stalled ribosome, adds...

in a codon of RNA, cytosine is synonymous with uracil, as they are interchangeable as the third base. When found as the second base in a codon, the third...

1967. His medical dissertation at Yale was titled, "Differences in RNA codon recognition as a function of cellular tRNA content". Beaudet completed a...

naturally. Arg residues are common components of proteins. It is encoded by the codons CGU, CGC, CGA, CGG, AGA, and AGG. The guanidine group in arginine is the...

number of possible codons is 64; hence, there is some redundancy in the genetic code, with some amino acids specified by more than one codon. Genes encoded...

nucleotides) directs the cell to translate UGA codons as selenocysteines (UGA is normally a stop codon). SECIS elements are thus a fundamental aspect...

terminator is located 69 bases downstream from the translational termination codon. The carboxy terminal portion of the protein exhibits extensive homology...

equate to amino acids or stop signals during translation, they are called codons. A single strand of a nucleic acid molecule has a phosphoryl end, called...

study it was shown that genes are expressed as non-overlapping triplets (codons). Researchers showed that mutations caused by either a single base insertion...

His doctoral thesis, submitted in 1992, was titled Studies of Synonymous Codon Evolution in Mammals and supervised by William G. Hill. Eyre-Walker joined...

albicans and C. tropicalis, but not, for instance, C. glabrata) the CUG codon, which normally specifies leucine, specifies serine in these species. This...

mutation is a point mutation in which a single nucleotide change results in a codon that codes for a different amino acid. It is a type of nonsynonymous substitution...

the AAGGag motif located about 6 nt (median distance) upstream of start codons as the consensus Shine–Dalgarno sequence in H. pylori. The proteome of H...

Crick. (Of course, 'unlike with unlike' increases the number of possible codons, if this scheme were a genetic code.) Goldstein, Bernard R. (1977) Ibn Mu'adh's...

the differences in the various mutations of the genome, in particular the codons on the 14 exons in the HEXB gene located within chromosome 5 (see figure...

could be as many as n3 codons. Research is currently being done to see if codons can be expanded to more than 3 bases. These new codons can code for new amino...

one serotype of the virus has been found, but multiple genotypes exist. Codon use within the genome is biased and unusually distinct from its host. It...

zwitterion structure −OOC−CH(NH+ 3)−(CH 2)2−COOH. It is encoded by the codons GAA or GAG. The acid can lose one proton from its second carboxyl group...

deletion in the 126th codon in exon 5 of the SOD1 gene. This mutation produced a frameshift mutation, which led to a stop codon at position 131. SOD1...

Escherichia coli, by reducing the natural number of 64 codons in the bacterial genome to 59 codons instead, in order to encode 20 amino acids. In 2020,...

readthrough site facilitates the mechanism of translation readthrough of the stop codon at the gag-pol junction producing the gag and pol fusion protein in certain...

methionine at codon 22. This mutation is found within and affects the FMN binding domain. (MTRR):c.524C>T – Serine to leucine substitution at codon 175. Benign...

Prime editing-mediated readthrough of premature termination codons (PERT) is a genome-editing strategy that corrects nonsense mutations. The method converts...

Tyr316Ter mutation in the coding region of FUT1. The mutation introduces a stop codon, leading to a truncated enzyme that lacks 50 amino acids at the C-terminal...

Paramecium, only UGA is decoded as a stop codon, while UAG and UAA are reassigned as sense codons (that is, codons that code for standard amino acids), coding...

classification, a climate classification system Triclocarban, a disinfectant TCC, a codon for the amino acid serine Take Command Console, a command line interpreter...

translates UGA to glycine, and CGG and GCA to tryptophan, as determined by the codon assignment software Codetta; it was further shown that these recodings are...

site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is used, and the encoded protein extends for...

entire coding sequence lies within the bounds (between the start codon and the stop codon) of a larger external gene. The coding sequence for a nested gene...

as follows: First, there emerged GNC primeval genetic codes involving 4 codons (GGC, GCC, GAC and GUC), which code 4 GADV-amino acids (glycine, alanine...

established in Kampala in 2008 Cursor Up (ANSI), an ANSI X3.64 escape sequence a codon for the amino acid leucine This disambiguation page lists articles associated...

ammeter cccDNA (covalently closed circular DNA), a special form of DNA CCC, a codon for the amino acid proline Chaos Computer Club, hacker organisation Citizen...

changes by e.g. truncation of C-terminus after introducing premature stop codon. Site-directed mutagenesis Phi value analysis missense mutation nonsense...

Seven Network reality TV show Agaritine, a hydrazine derivative AGT, a codon for the amino acid Serine Angiotensinogen, a protein Antiglobulin test,...

dipeptides and tripeptides thus revealing that UAG, UAA, and UGA are stop codons. Their Nobel lecture was delivered on 12 December 1968. Khorana was the...

that can precisely target a DNA sequence. Each zinc-finger can recognize codons of a desired DNA sequence, and therefore can be modularly assembled to bind...

1580 (nt) in the DNA sequence (CGT codon) causing the guanine to be replaced with the thymine, yielding CTT codon in the DNA sequence, results at the...

create start and stop codons, but it cannot destroy existing start and stop codons. A cryptic start codon is created when the codon ACG is edited to be...

initiation codons are those of lacI (GUG) and lacA (UUG) in the E. coli lac operon. Two studies have independently shown that 17 or more non-AUG start codons may...

Germany Gau (Final Fantasy VI), a character in Final Fantasy VI GAU, a codon for the amino acid aspartic acid Gouais blanc, a French wine grape Enfariné...

Lee, Ronald W. Smith, Gerald Solomon, Michael Moore, Chris McBee, Caryl Codon-Tharp, Faith Vecchio, Rebecca De Morrio, Joan Phillips Improbable Cause...

(Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein...

glycosylase; see Deamination Autoimmune autonomic ganglionopathy AAG, a codon for the amino acid lysine American Association of Geographers Association...

water at physiological pH), aliphatic amino acid. It is encoded by the codons AAA and AAG. Like almost all other amino acids, the α-carbon is chiral and...

switch from arginine (389R) to glycine (389G) at the 389 codon position. Arginine at codon 389 is highly preserved across species and this mutation happens...

David D. (June 2002). "An improved DNA‐based test for detection of the codon 616 mutation in the alpha cyclic GMP phosphodiesterase gene that causes...

found between codons 1460 and 1575. The 3C protease domains span codons 2183 to 2327. The usual eight RdRp domains are located between codons 2493 and 2828...

Genetic Code Variants Including the Reassignment of All Three Stop Codons to Sense Codons in Condylostoma magnum". Molecular Biology and Evolution. 33 (11):...

Position Original Nucleotide SNP Original Amino Acid Variant Amino Acid Codon 328 1212 T T Ser [S] Leu [L] 2 399 1424 G A Gly [G] Ser [S] 1 406 1446 C...

messenger RNA (mRNA) that immediately follows the translation termination codon. The 3′ UTR often contains regulatory regions that post-transcriptionally...

binding site (RBS), is a sequence of nucleotides upstream of the start codon of an mRNA transcript that is responsible for the recruitment of a ribosome...

messenger RNA interactions. Typically, if an incorrect tRNA pairs with an mRNA codon at the aminoacyl site of the ribosome, adenosines 1492 and 1493 are excluded...

spanning codons for amino acid positions 507 and 508 of the CFTR gene on chromosome 7, which ultimately results in the loss of a single codon for the amino...

DNA codons RNA codons This code (22) Standard code (1) TCA UCA STOP = Ter (*) Ser (S) TAG UAG Leu (L) STOP = Ter (*)...

particular, is abundant in tRNA anticodon loops and facilitates flexible codon recognition. Sheared G:A and reverse Hoogsteen A:U pairs commonly stabilize...

messenger RNA (mRNA) transcript, and can therefore be used to read the expected codon sequence that will ultimately be used during translation (protein synthesis)...

singer-songwriter Ochre River, Manitoba, in Canada Ochre, a type of genetics stop codon Ocher, alternative spelling of Ochyor, a town in Perm Krai, Russia Ogre...

SARS-CoV (about 155 codons) and SARS-CoV-2 (only 22 codons). Exacerbating the confusion, both the 57-codon protein product and the 22-codon protein product...

Additionally, a "start codon", and three "stop codons" indicate the beginning and end of the protein coding region. There are 64 possible codons (four possible...

performed several tasks related to annotation, such as base and codon counts. In fact, codon usage was the main strategy used by several early protein coding...

Multiple endocrine neoplasia type 2 (MEN2; also known as Pheochromocytoma (codons 630 and 634) and amyloid producing medullary thyroid carcinoma, PTC syndrome...

Tanja; Hugenholtz, Philip; Rinke, Christian (2021-12-01). "Recoding of stop codons expands the metabolic potential of two novel Asgardarchaeota lineages"....

and deletion generates conserved amino acid sequences and AUG initiation codons". Cell. 53 (3): 401–411. doi:10.1016/0092-8674(88)90160-2. ISSN 0092-8674...

in its DMD gene, changing the amino acid coding for a glutamine to STOP codon. This causes the muscle cells to produce a small, nonfunctional dystrophin...

of interest at its two ends. Only one codon of a three codon amino acid sequence is substituted. The type of codon set, will determine the number of sequences...

Dana-Farber/Harvard Cancer Center Links to digital facsimiles Leder's 'Codon notebooks' documenting the Nirenberg and Leder experiment can be found in...

some base pair locations more than others; for example, the third base of codon 249 of the p53 gene appears to be more susceptible to aflatoxin-mediated...

mRNA, but the stop codon is interpreted as an amino acid-encoding codon. In consequence, translation continues to the next stop codon. This leads to the...

nucleotide substitution are particularly high in the third position of a codon, where there is little functional constraint. This view is based in part...

approximately half these patients harbor point mutations of the BRAF gene at codon 600 substituting the amino acid glutamine for valine. A diagnosis from neurological...

The ingenuous 1964 Nirenberg and Leder experiment would identify the mRNA codons, a triplet sequence of ribonucleotides, that coded for each amino acid;...

fundamental building block of proteins in all life and is encoded by all codons starting with GG (GGU, GGC, GGA, and GGG). Because of its minimal side chain...

American strains around 1892. Scans for natural selection showed that most codons of the SLE virus ORF were evolving neutrally or under negative selection...

PMC 9653231. PMID 36350219. Erives A (August 2011). "A model of proto-anti-codon RNA enzymes requiring L-amino acid homochirality". Journal of Molecular...

genetic code between species possessing this alternative code is that the codon CUG (normally encoding the amino acid leucine) is translated by the yeast...

libraries (formed by de novo gene synthesis where alternative nucleotides or codons are incorporated). DNA library technology is a mainstay of current molecular...

2 protein, mutations in codons specifying 67 different residues have been identified, with multiple mutations in the codons of several amino acids. The...

an extra 29 amino acid long extension. The WbSXP-1 variant, where a stop codon has been introduced at the amino acid position 153 has been shown to be...

optimizing protein over-expression. Contact Primary citation Wu & al. (2007) Release date 2006 Access Website http://www.umbc.edu/codon/sgdb/index.php...

single mRNA transcript larger than 16 kb. ApoB48 is generated when a stop codon (UAA) at residue 2153 is created by RNA editing. There appears to be a trans-acting...

of C4orf17 in humans. It is annotated to highlight exons, start and stop codons, and disordered regions among other genetic features. C4orf17 has a total...

Assertive community treatment, a system for treating mental illness ACT, a codon for the amino acid Threonine ACT (audio format), a file format Act or S-act...

with its putative binding interaction to the target mRNA sodB. The start codon for sodB is underlined. RyhB nucleotides that participate in the interaction...

reduced evolution rates. Sperm genes have short coding sequences, high codon bias, and disproportionate representation among orphan genes. These characteristics...

S2CID 25912333. He W, Zhang H, Zhang Y, Wang R, Lu S, Ji Y, et al. (October 2017). "Codon usage bias in the N gene of rabies virus". Infection, Genetics and Evolution...

Scott JF, Gerstenblith MR (eds.). Noncutaneous Melanoma. Brisbane (AU): Codon Publications. ISBN 978-0-9944381-5-7. PMID 29874016. Retrieved 2026-06-27...

alpha-glucosidase, also known as glucosidase, alpha; acid, an enzyme a codon for glutamic acid GADA 601, Argentine Army unit Grupo de Artillería Antiaérea...

Clinical Significance Rs963273525 Amino Acid 1 TC MetVal Missense In start codon (CDS) N/A Rs1800736098 Base pair 8 CA N/A Transversion mutation Conserved...

"Synthesis of guanosine tetra- and pentaphosphate requires the presence of a codon-specific, uncharged transfer ribonucleic acid in the acceptor site of ribosomes"...

Holmes Dobson, Virginia Grobeson, Leslie Ann Anderson, Laura Connolly, Caryl Codon-Tharp, Carol Pershing CBS Babylon 5 "The Geometry of Shadows" Tracy Smith...

developed in the Chomskyan tradition Tryptophan, written as TGG in the DNA codon table This disambiguation page lists articles associated with the title...

acids do not have a dedicated codon, but are added in place of a stop codon when a specific sequence is present, UGA codon and SECIS element for selenocysteine...

humans, meaning the body can synthesize it as needed. It is encoded by the codons GAU and GAC. In proteins aspartate sidechains are often hydrogen bonded...

University, a state health sciences university in Uttarakhand, India A codon for the amino acid tyrosine UAU: A subunit of South Korean girl group, Dreamcatcher...

likelihood phylogenetic tree based on 13 protein-coding genes partitioned by codon, and nodes with less than 70% bootstrap support are collapsed, forming polytomies...

commonly used in citrus here. Schmidt et al., 2006 find point mutations at codon 200 conferring TBZ resistance are common in California. Karnal Bunt (Tilletia...

within the unusually long sequence of this gene can cause premature stop codons or other defects. Titin mutations are associated with hereditary myopathy...

sequencing whole mitochondrial genomes. ATA, GTG and TTG ATT is the start codon for the CytB gene in Halocynthia roretzi. List of genetic codes This article...

of repeats in the open reading frame can affect the codon sequence by adding a premature stop codon or by changing the sequence of the protein. This often...

f9c186b5-5bdf-42f6-b105-b8071c370c67 Open Tree of Life: 670513 PLANTS: CODON POWO: urn:lsid:ipni.org:names:5656-1 Tropicos: 40011401 WFO: wfo-4000008798...

possible codons, while an expanded DNA alphabet with 9 DNA bases would have 93 = 729 possible codons, many of them synthetic codons. For these codons to be...

virus to have a noticeable codon usage bias. For instance, arginine's six different codons have a relative synonymous codon usage of AGA (2.67), CGU (1...

composition (uuu) -- triple up quarks UUU, or uracil uracil uracil, the RNA codon for phenylalanine Uranium One (TSX: UUU, JSE: UUU), Canadian-based uranium...

Diagram depicting gelsolin and the amyloid protein derived from it because of mutations in codon...

other RNA helicases such as Ded1/DDX3 and DHX29) to locate the start codon. Start codon recognition occurs through base-pairing between the Met-tRNAiMet and...

Zhifeng; Wedenoja, Juho; et al. (2010). "A population-specific HTR2B stop codon predisposes to severe impulsivity". Nature. 468 (7327): 1061–6. Bibcode:2010Natur...

are produced from the same reading frame which contains an UAG stop codon at codon 196, which normally produces only the small-HDAg. However, editing by...

produce a single protein due to ribosomal readthrough of a leaky UAG stop codon. The four genes encode a replicase (with methyltransferase [MT] and RNA...

Change Function Description rs1456067444 554 1 [T/G] [M/R] missense start codon rs749501877 679 46 [A/G] [N/S] missense N-glycosylation site rs776889950...

ORF 11 of the PR toxin biosynthetic cluster introduces a premature stop codon; a deletion in the lipase/esterase domain of the mpaC gene prevents MPA...

translation) causes ribosomes to have a higher rate of read-through of stop codons, an effect that results in suppression of nonsense mutations in other genes...

the genetic code and were able to determine the sequences of 54 out of 64 codons in their experiments. In 1972, Walter Fiers and his team at the Laboratory...

eukaryotes. The 3' UTR is found immediately following the translation stop codon. The 3' UTR plays a critical role in translation termination as well as...

things related to the number three, such as Bronze (award for third place), Codon (which has three nucleotides) and Wise Monkey. In 2023, the launch of the...

In addition, it was found that an amber mutation produces a "nonsense codon" within a gene that causes polypeptide chain termination during translation...

gene variants is caused by a single nucleotide polymorphism in the start codon of the gene which can be distinguished through the use of the Fok1 enzyme...

airport code for Camilo Daza International Airport, Cúcuta, Colombia CUC, codon for the amino acid leucine This disambiguation page lists articles associated...

start the Biobricks Foundation. He was also a co-founder of the now-defunct Codon Devices, a biotechnology startup company that aimed to commercialize synthetic...

Amino Acids in Deep-Level Arthropod Phylogenomics: Differentiating Serine Codons in 21-Amino-Acid Models". PLOS ONE. 7 (11) e47450. Bibcode:2012PLoSO...747450Z...

Holmes Dobson, Virginia Grobeson, Leslie Ann Anderson, Laura Connolly, Caryl Codon-Tharp, Carol Pershing CBS Babylon 5 "The Geometry of Shadows" Tracy Smith...

Conceptual translation of TMED5. Labeled are the start and stop codon, exon splice sites, domains and motifs, polyadenylation signals, predicted RNA and...

of Medicine, in 1997. Some sORF are so small, usually shorter than 100 codons, that they were believed to have no protein-coding genes to make functional...

in exon 1 of the human MBL2 gene, at codon 52 (Arg to Cys, allele D), codon 54 (Gly to Asp, allele B) and codon 57 (Gly to Glu, allele C), also independently...

amino acid Glutathione hydrolase, an enzyme that hydrolyzes glutathione A codon for the amino acid Glycine Germline gene therapy, to treat genetic diseases...

lactidomycin to prevent any further initiation. This allows the starting codon of the mRNAs throughout the cell lysate to be analyzed, which has been used...

viral DNA. E1 is the largest open reading frame (ORF), which is the set of codons in the genome that code for proteins, encoding a 602 amino acid protein...

ability, increasing expression and stimulating neutralizing antibodies; a codon-optimized gene of the full-length spike protein of SARS-CoV-2 (bases 103–3879);...

histidine: guanine (G)-> adenosine (A) transition in the second codon position of the 74th codon in the protein) mutation in the PRKAR1A gene, confirming a...

translation but can also bind to uracil and adenosine, though it is not favored. Codon changes may arise from RNA editing leading to changes in the coding sequences...

receptor type-1, a BMP type-1 receptor. The mutation causes substitution of codon 206 from arginine to histidine in the ACVR1 protein. This substitution causes...

to reflect mutational tendencies. Mutational biases also contribute to codon usage bias. Although such hypotheses are often associated with neutrality...

Office of the Inspector General (Brazil), abbreviated CGU in Portuguese a codon for the amino acid arginine a cash generating unit, an IFRS accounting term...

allele in the Agouti gene in dogs (R96C arginine to cysteine mutation at codon 96). This recessive black gene is also thought to have derived from wild...

mutations that prematurely terminate the synthesized protein (early stop codon). The term pharmacogenomics is often used interchangeably with pharmacogenetics...

Nonsan, South Korea Gban language Geological Survey of Greenland GGU, a codon for the amino acid glycine Good Game University, now Team Coast, an eSports...

Composite Likelihood Model Syn-Nonsynonymous - Sequences are compared codon-by-codon, only available for protein coding sequences. Nei-Gojobori Method Modified...

reveals a predominance of mutations that create a premature-termination codon". American Journal of Human Genetics. 60 (3): 515–524. PMC 1712503. PMID 9042910...

is considered to be more stable in eukaryotic cells due to being human codon optimized and utilizing three minimal transcriptional activation domains...

to a pre-mature stop codon mutation in a dystrophin sequence to activate A-to-I editing of the stop codon to a read through codon in a model xenopus cell...

the ribosome's A site for the UGA codon to be decoded. In bacteria, the SECIS element occurs soon after the UGA codon it activates. The situation with...

pathway Tyrosine aminotransferase, an enzyme encoded by the TAT gene TAT, a codon for the amino acid Tyrosine Talbot railway station, Australia Tattenham...

the codons match or not by examining whether the codon and anticodon are bound will not be able to tell the difference between wrong and right codon with...

mineral Carbonic anhydrase inhibitor, in pharmacology Codon Adaptation Index, a measure of codon bias in protein-coding DNA sequences Cold air intake,...

A Spot-tag is a 12-amino acid peptide tag recognized by a single-domain antibody (sdAb, or nanobody). Due to the small size of a Spot-tag (12 amino acids)...

The Gulf Clan), a drug cartel and paramilitary group in Colombia AGC, a codon for the amino acid serine Agra Cantonment railway station in Uttar Pradesh...

families. This mutation converts a highly conserved arginine to histidine at codon 340 in the NADH dehydrogenase subunit 4 of complex I of the mitochondrial...

mammals; the human and murine sequences are identical. However, the start codon of human FNDC5 is mutated to ATA.[citation needed] This causes human FNDC5...

Transport's ICAO code CTT, a specialty certification of Comp TIA CTT, a codon for the amino acid Leucine × Cattlianthe (Ctt.), a nothogenus of orchids...

between G→A results in an amino acid change from valine to methionine at codon 158. The A or Met allele is associated with lower enzymatic activity (due...

reported mutation was truncating (nonsense or frameshift) and occurred between codons 2,407 and 2,517 in exon 34, resulting in the loss of three C-terminal AT-hook...

that can cause CNC, with many of these mutations producing premature stop codons, thus resulting in the complete loss of PRKAR1α protein. CNC patients have...

the 3' end. Codon use is not random; codons ending in adenosine are favoured, and those ending in cytosine or guanine are avoided. Codon use differs between...

traits such as karyotype (chromosome number), genome size, gene order, codon usage bias, and GC-content to determine what mechanisms could have produced...

include exon boundaries, poly A signal, poly A site, and start and stop codons. Protein annotations include a domain of unknown function (DUF4562), FHA...

exons, a coding sequence of 1881 nucleotides, and an upstream in-frame stop codon. The coding sequence is the 36-660 bases of the gene TMEM212. Other genes...

are more evenly distributed. The 5 exons of the APRT gene are indicated (blue), and the start (ATG) and stop (TGA) codons are emphasized (bold blue)....

'haplotype'. This haplotype, Super-B8, is A1-Cw7-B8-DR3-DQ2, about 2 million DNA codons (the nucleotide building blocks) long. This chunk has avoided recombination...

initiation codon of the EBNA-LP coding region is created by an alternate splice of the nuclear protein transcript. In the absence of this initiation codon,...

with conversion to preferred mammalian codons, the removal of reported cryptic splice sites, an altered stop codon, and reduced CpG content to reduce the...

Ultimatrix, which is synced to the prototype Omnitrix's DNA source, the Codon Stream. Ben has wielded the Ultimatrix for over a year since defeating Vilgax...

computer chip AMBER (Very Large Telescope) Amber mutation, a type of stop codon in genetics A unit of volume according to the Winchester measure Amber Highway...

synthesis factories in the cell. It is coded so that every three nucleotides (a codon) corresponds to one amino acid. In eukaryotic cells, once precursor mRNA...

factor Tachyarrhythmia absoluta, a form of cardiac arrhythmia TAA, a stop codon in molecular biology Thoracic aortic aneurysm Tanganyika African Association...

these pause sites were tested with specific codons. No link was found between the occupancy of specific codons and amount of their tRNAs. Thus, the early...

survival. Gain-of-function missense mutations which primarily occurs at codons 12, 13, and 61, maintain RAS in an active state. These RAS proteins act...

literature. For instance, mutation biases are frequently invoked in models of codon usage. Such models also include effects of selection, following the...

common hotspots in several human cancers, which are on codons 175, 248 and 273. The other two codons are 280 and 285 do not have CpG sites. These sites are...

known single stranded RNA virus (~70%). Despite this high GC content its codon use is similar to that of its human host. The viruses attach to the cell...

1ab is produced due to ribosomal slipping near the polyprotein 1a stop codon. The polyproteins are translated into proteins involved in genome replication...

stop codons (leading to early termination of protein synthesis and truncated proteins). Aminoglycosides can cause the cell to overcome the stop codons, insert...

ORF's (Open Reading Frame which is an incessant stretch of codons that do not contain a stop codon). Four nonstructural proteins are encoded on two-thirds...

proteins. During the 1980s, selenocysteine was shown to be encoded by the codon UGA. The recoding mechanism was worked out first in bacteria and then in...

proposed. Most of these involve translating each letter into a corresponding "codon", consisting of a unique small sequence of nucleotides in a lookup table...

Hayashi-Ishimaru; T Ohama; Y Kawatsu; K Nakamura; S Osawa (June 1996). "UAG is a sense codon in several chlorophycean mitochondria". Current Genetics. 30 (1): 29–33...

Graphics Core Next, an AMD graphics microarchitecture series Degenerate codon for the amino acid Alanine (A) Grand Canyon National Park Airport (IATA...

Watanabe; T. Nakase (25 August 1993). "Non-universal decoding of the leucine codon CUG in several Candida species". Nucleic Acids Res. 21 (17): 4039–45. doi:10...

has been used for over 60 years, and notably, the first elucidation of a codon was done by Marshall Nirenberg and Heinrich J. Matthaei in 1961 at the National...

isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by...

fictional military contractor in the Doom video game franchise UAC, a codon for the amino acid tyrosine This disambiguation page lists articles associated...

shift mutation at the glycosyltransferase domain (c.1457insG) located at codon 486 of exon 6 of the EXT1 gene, that causes multiple osteochondromas. This...

machines for separation of mixed plant-pathogen EST collections based on codon usage (ECLAT)". Bioinformatics. 21 (8): 1383–8. doi:10.1093/bioinformatics/bti200...

Универзитет Црнe Горe) Serine, a proteinogenic amino acid, specified by redundant codons in the genetic code that include UCG UCG or United Communications Group...

Conceptual Translation of KLHL36 Transcript Variant 1 mRNA, including BTB/POZ domain, BACK domain, Kelch Motifs, start and stop codons, and exon boundaries....

in which some amino acids are encoded by more than one codon in the DNA. Although the codons produce the same amino acids, they have an effect on the...

The reason for this periodicity is due to the biased distribution towards codon triplets, which is a consequence of genetic code degeneracy; while non-coding...

said to mean 'seven bells' with a second element derived from Greek κώδων (codon) - 'bell', but was in fact coined by Arnold Arboretum taxonomist Alfred...

patients with chronic urticaria". Allergologia et Immunopathologia. 44 (4). Codon Publications: 286–291. doi:10.1016/j.aller.2015.10.004. ISSN 0301-0546....

bacterial species sequenced by 2009. These elements carry core genes and have codon usage similar to the chromosome, yet use a plasmid-type replication mechanism...

twice as likely as a control group to have a mutation in the TP53 gene (codon 72 polymorphism). Patients with higher grade tumors exhibited more proline...

Survivors – What Do We Know Today?", Wilms Tumor, Codon Publications, pp. 131–145, doi:10.15586/codon.wt.2016.ch9, ISBN 978-0-9944381-1-9, PMID 27512760...

tryptophan (Trp) for propagation were isolated. As Trp is only coded by a single codon, some evidence shows that Trp can be displaced by 4FTrp in the genetic code...

subunit (30S), which then assembles other translation machinery. The start codon, typically found 8 nucleotides downstream of the Shine-Dalgarno sequence...

the existence of genetic assimilation in evolution; in yeast, when a stop codon is lost by mutation, the reading frame is preserved much more often than...

nucleotides is not divisible by three, i.e., the number of nucleotides per codon. Frameshift mutations will alter all the amino acids encoded by the gene...

alignment-free methods– using features such as k-mer composition analysis, codon usage, and GC content, to measure similarity between viral and host sequences...

1962 (southern Africa) Capocles Emeljanov, 2004 Capenopsis Melichar, 1912 Codon Fennah, 1962 Strongylodemas Stål, 1853 Tecmar Fennah, 1962 Xosopharinae...

group A allele, a guanosine base is subsequently deleted. A premature stop codon results from this frame-shift mutation. This variant is found worldwide...

aegypti (the yellow fever mosquito) and studies of chromosomal inversions, codon usage bias, and speciation mechanisms. He has contributed to understanding...

operon. First, Yanofsky observed that the ORF contained two tandem Trp codons and the protein had a Trp percent composition which was about 10X normal...

RG, Kerr IB, Mehta AR, et al. (April 1991). "High frequency mutation in codons 12 and 61 of H-ras oncogene in chewing tobacco-related human oral carcinoma...

the AUA codon in many archaea and is required for aminoacylation of tRNAIle2 with isoleucine. The genetic code describes how triplet codons on mRNA are...

it is caused by a nonsense mutation in codon 1027 of the COL4A5 gene on the X chromosome (glycine to stop codon), which is similar to Alport's syndrome...

contain a "leaky" stop codon. In TMV 95% of the time the host ribosome will terminate the synthesis of the polypeptide at this codon but the rest of the...

'live attenuated SARS-CoV-2 Vaccine or COVID-19 vaccine' using the latest codon de-optimization technology. Indian Immunologicals Limited Collaborates on...

involved in detection of correct Watson-Crick pairing between the codon and anti codon. When correct interactions are achieved, the binding provides energy...

first worked at the biotechnology company Armos Corporation then Codon Corporation. Codon was purchased by Schering AG and became Berlex Biosciences. In...

Individual Achievement in Hairstyling for a Series Josée Normand, Caryl Codon, Rebecca De Morrio, Dino Ganziano, Virginia Kearns, Audrey Levy, Shawn McKay...

protein that is defective. The other mutation involves the deletion of a codon, three nucleotides that code for a lysine (Lys). In the wrinkled frog (Glandirana...

neurological circuits related to limb movement and motion, causes a premature stop codon in horses with lateral ambling gaits. This mutation may be a dominant gene...

Retrieved 2026-05-06. Seitz, Kiley W.; et al. (2021). "Recoding of stop codons expands the metabolic potential of two novel Asgardarchaeota lineages"....

but in the end chose only the three-letter name after learning about the codons of the genetic code, which can be represented in groups of three letters...

to the high mutation rate of mtDNA in animals, the 3rd positions of the codons change relatively rapidly and thus provide information about the genetic...

glutamine codon "CAG" and is thus known as the polyglutamine tract. The second microsatellite contains 4 to 31 repetitions of the glycine codon "GGC" and...

This occurs when the insert is "in frame" with the LacZα gene and a STOP codon is absent in the insert. This can lead to the expression of a fusion protein...

the mutation responsible for the most common allele is a deletion of one codon within a very short triplet repeat (GAC), in which the 469th amino acid...

code, where each triplet (called a codon) specifies a particular amino acid. Furthermore, it was shown that the codons do not overlap with each other in...

the result of Jones' regular use of a metaphor of nucleotides as letters, codons as words and genes as sentences, but also reflecting Jones' short explanation...

to the standard genetic code, described at Genetic code#RNA codon table (see also DNA codon table) This disambiguation page lists articles associated with...

in the Vpu translation initiation codon but have otherwise intact vpu genes. Since removal of the Vpu initiation codon results in increased expression of...

of a structural gene (e.g., DNA polymerase binding site, start and stop codons, and splicing sites) serve as constants of the computational gene, while...

Aspartate transaminase, or aspartate aminotransferase, an enzyme AAT, a codon for the amino acid asparagine Achanalt railway station Asia Airfreight Terminal...

are primarily insertion/deletion mutations that result in premature stop codons. It is hypothesized that these mutations occurred in cetaceans already possessing...

Analysis of mRNA Methylation Reveals Enrichment in 3′ UTRs and near Stop Codons". Cell. 149 (7): 1635–1646. doi:10.1016/j.cell.2012.05.003. PMC 3383396...

the minimal LamB1 IRES motif between -293 and -1 upstream of the start codon. RNA affinity purification demonstrated that the La protein interacts with...

sequence translator which can be used for designing degenerate primers for codons that code for multiple amino acid sequences. It is also understood that...

Fieldata, in IBM "BCD" format, and in Braille. Enough to uniquely identify one codon of genetic code. The size of code points in Base64; thus, often the entropy...

to tumor regression. This research, which provided evidence that skewed codon distributions may evolve in response to metabolic states, was featured as...

conjecture, a mathematical conjecture proved in 2014 by Thomas Royen GCC, a codon for the amino acid alanine Gibbon Conservation Center, in Santa Clarita...

2019, Start Codon, a UK based life sciences accelerator system announced its partnership with Calira. Calira would provide Start Codon's clients with...

hormone-like protein. Variations in structure, receptor specificity, and codon sequence occur even between different strains of the same species. However...

from this genome. 85% of these predicted proteins contained start and stop codon, and 12% contained an N-terminal secretion signal sequence, which is an...

Salamanders: Relaxed Purifying Selection and Presence of Positively Selected Codon Sites in the Family Plethodontidae". International Journal of Genomics....

stop codon. Another type of mutation that deals with stop codons is known as a nonstop mutation or readthrough mutation, which occurs when a stop codon is...

ciliate Paramecium caudatum reveals a shift in nucleotide composition and codon usage within the genus Paramecium". BMC Genomics. 12 272. doi:10.1186/1471-2164-12-272...

identification, the most commonly identified disablements are premature stop codons and frameshifts, which almost universally prevent the translation of a functional...

County, Romania, called Aga in Hungarian Monte Aga, mountain in Italy AGA, a codon for the amino acid arginine Aga (bird), Chamorro language name of Corvus...

due to alteration in the 3rd coding causing redundancy. For example, the codon CUA is mutated into CUG; which still codes for leucine, therefore not making...

Parkinson's Disease: Pathogenesis and Clinical Aspects, Brisbane (AU): Codon Publications, pp. 83–106, doi:10.15586/codonpublications.parkinsonsdisease...

Wisniewski T (2019). Wisniewski T (ed.). Alzheimer's Disease. Brisbane (AU): Codon Publications. p. 38. ISBN 978-0-646-80968-7. PMID 31895508. Rocha GS, Freire...

runtime environments for a number of other languages, including Crystal, the Codon high performance python compiler, the GNU Compiler for Java runtime environment...

start codon, exon boundaries, polyadenylation signals, polyadenylation sites, disordered region, region excluded from isoform 2, and stop codon. Amino...

(Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein...

display, end clipping, and consensus determination; other programs like CodonCode Aligner also implement quality-based consensus methods. Quality scores...

Archived from the original on April 19, 2015. Retrieved April 22, 2015. Codon, Patrick (April 20, 2015). "Senate votes to bar state money for soccer stadium"...

even 100,000, compare "cien mil requetés de la última cruzada", José María Codon Fernández, Tradición y monarquia, Sevilla 1961, p. 17, and this figure is...

food additive, cysteine has the E number E920. Cysteine is encoded by the codons UGU and UGC. Like other amino acids (not as a residue of a protein), cysteine...

bioinformatics platforms. It is fully integrated into software programs such as CodonCode Aligner, DNASTAR's Lasergene, Geneious, and MacVector, and is also available...

with the visual motifs in the book. The genetic code has a codon entropy of 5.97 bits/codon, much higher than any natural DNA sequence known. However,...

the alternative genetic code of its mitochondria which use TTA as a stop codon instead of coding for Leucine. This code is represented by NCBI translation...

GC-rich codons (Gly, Ala, Arg, Pro), and likewise, adaptive walks under AT bias result in proteins with more of the amino acids with AT-rich codons (Phe...

acids. A protein is created by ribosomes that "read" RNA that is encoded by codons in the gene and assemble the requisite amino acid combination from the genetic...

There are 35 different known mutations of WRN, which correspond to stop codons, insertions, or deletions that result in a frameshift mutation. These mutations...

revealed a higher proportion of valine homozygous (VV) genotype on the codon 129 of the gene encoding the prion protein (PRNP) compared with the general...

53) Editing results in a codon change from a glutamine codon (CAG) to an arginine codon (CIG). Editing at R/G results in a codon change. The region of the...

residues in mRNA can affect the coding specificity of stop codons UAA, UGA, and UAG. In these stop codons, both a U→Ψ modification and a U→C mutation promote...

information that encodes the primary structure of a protein, and contains codons that code for each amino acid. The ribosome creates the protein chain by...

the use of adaptable codons and low-fidelity polymerases during somatic hypermutation. A similar driving force for biased codon usage as a result of productively...

sickle cell disease. HbS is produced by a point mutation in HBB in which the codon GAG is replaced by GTG. This results in the replacement of hydrophilic amino...

was composed of sequences of three DNA base pairs known as triplets or codons which represent one of the twenty amino acids. Genetic coding helped researchers...

nucleotide polymorphisms (SNPs) that can occur in tmem242. A few cause stop codons, others make either silent mutations or missense mutations. The TMEM242...

"molecular mechanism of lysidine synthesis that determines tRNA identity and codon recognition". Molecular Cell. 19 (2): 235–46. doi:10.1016/j.molcel.2005...

Holmes Dobson, Virginia Grobeson, Leslie Ann Anderson, Laura Connolly, Caryl Codon-Tharp, Carol Pershing CBS Babylon 5 "The Geometry of Shadows" Tracy Smith...

stem that meet in a cloverleaf pattern. The anticodon that recognizes a codon during the translation process is located on one of the unpaired loops in...

is highly fragmented and the mitochondrial mRNAs use non-canonical start codons (ATA, ATT, TTG, and GTG). Some aspects of Oxyrrhis' nuclear and chromosomal...

now thought that the RBM8B locus is a pseudogene. Two alternative start codons result in two forms of the protein, and this gene also uses multiple polyadenylation...

mammals. In most species, stop codon is TAA, and TGA in Mus musculus. Deletions, insertions and mutations of stop codons affect the coding part and its...

acid similarities based on how many base changes were required to change a codon to code for that amino acid. This model is better, but it doesn't take into...

Thyroid Association ATA chapter numbers Alternating timed automaton ATA, a codon for the amino acid isoleucine American Taekwondo Association American Tennis...

Employer NVIDIA Known for Free software development and advocacy Awards Free Software Award Website mjg59.dreamwidth.org or codon.org.uk/~mjg59/blog/...

The tpi mRNA has a conserved structural element located close to the stop codon. Binding of the asR3 may be able to compete against the formation of the...

", by David Guetta from Listen Stop (dog), a part of a dog's skull Stop codon, a type of RNA molecule in genetic code STOP protein, a protein in animals...

non-translation of the intracellular domain due to the presence of a stop codon. This truncated version of GHR is cleaved more frequently into GHBP and...

Gua (disambiguation), the name of two different communes in France GUA, a codon for the amino acid valine Gua or Guanine, a nucleobase found in the nucleic...

mutations were identified, cluster I at codons 507-533, cluster II at codons 563-572, and cluster III at codon 687. The majority of these mutations are...

which can saturate up to five independent codons on a gene. This method removes redundant codons and stop codons. This is a PCR based method. Cassette mutagenesis...

Schwartz et al. 2004, 2009 CodonCode Aligner Fast pairwise and multi-sequence alignments with multiple algorithms. Nucleotide Both CodonCode Corporation 2003-2025...

196, results in an amino acid switch: valine to methionine exchange at codon 66, Val66Met, which is in the prodomain of BDNF. Val66Met is unique to humans...

an eight-nucleotide scar sequence, which codes for a tyrosine and a stop codon, is left between every segment added into the plasmid. Golden Gate assembly...

travels to the planet Aranhaschimmia to investigate a disturbance in the Codon Stream, discovering that the planet has become infested with DNAliens. On...

poly-A site at the end of the gene and two located upstream from the start codon. The gene is highly expressed in bone marrow and lymph nodes, suggesting...

particular feature: it translates the CUG codon into serine rather than leucine. Due to this different codon usage it is difficult to use the model system...

the start codon region of Bcl-2 mRNA. In vitro studies led to the identification of oblimersen, which is complementary to the first 6 codons of Bcl-2 mRNA...

associated with widespread neurodegeneration. The allele which encodes leucine, codon 132 in the family of Elks, is either homozygous LL, homozygous MM, or heterozygous...

hyperphagia. A nonsense mutation in the leptin gene that results in a stop codon and lack of leptin production was first observed in mice. In the mouse gene...

American Accounting Association American Arbitration Association AAA, a codon for the amino acid lysine Amino acid analysis Aromatic amino acids Arylalkanolamine...

Analytical ultracentrifugation, Physical and biophysical chemistry instrument a codon for the amino acid isoleucine Aalborg University, formerly Aalborg University...

PMID 12200435. Infante J, Llorca J, Rodero L, et al. (2003). "Polymorphism at codon 174 of the prion-like protein gene is not associated with sporadic Alzheimer's...

protein, usually due to a nonsense mutation that introduces a premature stop codon into the mRNA.[citation needed] If an exon with an appropriate number of...

This duplication that caused the frameshift resulted in a premature stop codon in the ROGDI gene after the 19th amino acid. A mutation called c.507delC...

bacteria Global Technology Associates, an Internet firewall maker GTA, a codon for the amino acid valine GTA Teleguam, a telecommunications company in...

techniques to experience structural evolutions in 3D architecture. These include codon usage frequency similarity (CUFS), paralog gene co-regulation, and spatially...

amino acid matching the anticodon of the tRNA, and in turn matching the codon of the mRNA, is used during protein synthesis. In order to prevent translational...

two corresponding RNA bases included in two new codons, additional tRNAs recognizing these new codons (these tRNAs also contained two new RNA bases within...

co-discoverer of the amber-mutants that led to the recognition of stop codons Franz Steindachner (1834–1919), Austrian ichthyologist and herpetologist...

of non-uniformity in genomic sequences. When a codon is artificially substituted with a synonymous codon, it often results in a lethal change and cell...

sources that use the Boraginales Working Group system were: Codonaceae Codon L. Coldeniaceae Coldenia L. Cordiaceae Cordia L. Varronia P.Browne Ehretiaceae...

Wimmer E, Mueller S (2008). "Virus attenuation by genome-scale changes in codon pair bias". Science. 320 (5884): 1784–7. Bibcode:2008Sci...320.1784C. doi:10...

11 James Gottier 6 Tommy Tokoph 6 Tommy Tokoph 11 Mika Immonen 11 Pedro Codon 4 Gabe Owen 10 Billy Dugan 11 Billy Duggan 2 Robb Saez 11 Robb Saez 11 Dustin...

recognition of the corresponding mRNAs' codons. In the absence of queuosine modification, translation at Q-decoded codons slows down to the point that many...

sometimes been referred to as ORF9a, resulting in a downstream ORF of 76 codons in SARS-CoV, also overlapping with the N gene, being designated ORF9b. The...

translation system, with which he discovered that naturally "leaky" termination codons exist in plant virus RNAs, and achieved the first correct synthesis and...

with this syndrome have an identical genetic change, an inframe single codon deletion in POLD1 resulting in a loss of serine at position 605. The POLD1...

due to insertion of 23-base-pair sequence, exon14a, that contains a stop codon. The inserted sequence is flanked by two introns marked with GT/AG donor-acceptor...

therapeutic research and drug screenings. HCT116 cells have a mutation in codon 13 of the KRAS proto-oncogene, and are suitable transfection targets for...

Duon may refer to the following things: A DNA codon also serving as part of a transcription factor binding site Moel y Cerrig Duon, a summit in north...

resulting structure interacts with the codon CAA at codon 2153 and deaminates it into UAA, producing a stop codon that results in mRNA that is translated...

have lost their function due to a frameshift mutation or premature stop codons. The baiji has the lowest single-nucleotide polymorphism (SNP) frequency...

that occurs between tRNAs and mRNAs at the third base position of many codons during transcription and during the charging of tRNAs by some tRNA synthetases...

because the genetic code itself is degenerate, meaning several different codons can code for the same amino acid. This allows different organisms to have...