Share to: share facebook share twitter share wa share telegram print page

William Phips

William Phips
1st Governor of the Province of Massachusetts Bay
In office
May 16, 1692 – November 17, 1694
MonarchsWilliam III and Mary II
LieutenantWilliam Stoughton
Preceded bySimon Bradstreet (as governor of the Massachusetts Bay Colony)
Succeeded byWilliam Stoughton (acting)
Personal details
BornFebruary 2, 1650/51
Nequasset (Woolwich, Maine)
DiedFebruary 18, 1694/95 (aged 44)
London, Kingdom of England
SpouseMary Spencer Hull (married 1673)
Signature
NicknameThe New England Knight

Sir William Phips (or Phipps; February 2, 1651 – February 18, 1695)[Note 1] was born in Maine in the Massachusetts Bay Colony and was of humble origin, uneducated, and fatherless from a young age but rapidly advanced from shepherd boy to shipwright, ship's captain, and treasure hunter, the first New England native to be knighted, and the first royally appointed governor of the Province of Massachusetts Bay. Phips was famous in his lifetime for recovering a large treasure from a sunken Spanish galleon but is perhaps best remembered today for establishing the court associated with the infamous Salem Witch Trials, which he grew unhappy with and was forced to prematurely disband after five months.

Early life

Coat of Arms of William Phips

Phips was born the son of James and Mary Phips in a frontier settlement at Nequasset (present-day Woolwich, Maine), near the mouth of the Kennebec River,[1] on February 2, 1651.[2] His father died when the boy was six years old, and his mother married a neighbor and business partner, John White.[1] Although Cotton Mather in his biography of Phips claimed that he was one of 26 children, this number is likely an exaggeration or includes many who did not survive infancy. His mother is known to have had six children by James Phips and eight by White.[3] His father was poor, but his ancestry may have descended from country gentry in Nottinghamshire, at least technically. Constantine Phipps, Lord Chancellor of Ireland, seems to have been a cousin of Phips, five years his junior.[4]

Phips watched over his family's flock of sheep, according to Mather, until the age of 18, after which he began a four-year apprenticeship as a ship's carpenter. He received no formal schooling. Despite a keen intelligence, his literacy skills were likely rudimentary. Robert Calef wrote, "It will be generally acknowledged, that not withstanding the meanness of his parentage and education, he attained to be master of a Ship."[5] Once Phips achieved wealth and fame, he relied on a personal secretary and scribes for assistance, as was common for many figures of the time.[6]

After his apprenticeship ended in 1673, Phips traveled to Boston, where he continued to employ his shipmaking and carpentry skills.[7] About a year later, he married Mary Spencer Hull, widow to John Hull (unrelated to Massachusetts mintmaster John Hull).[8] Mary's father, Daniel Spencer, was a merchant and landowner with interests in Maine. Phips may have known Mary from an early age.[9] By all accounts, the couple exhibited "genuine affection" for one another, and there is no evidence Phips was unfaithful during his long absences from home.[10]

Phips established a shipyard on the Sheepscot River at Merrymeeting Bay in Maine in 1675 at the outbreak of King Philips War. The shipyard was successful, turning out a number of small boats[11] and building its first large merchant ship in 1676. As he was preparing for its maiden voyage in August 1676, planning to deliver a load of lumber to Boston, a band of Indians descended on the area during the Northeast Coast Campaign (1676).[12] Rather than take on his cargo, he took on board as many of the local settlers as he could. Although he was financially ruined (the Indians destroyed the shipyard and his intended cargo of masts and lumber), Phips was considered a hero among the colonists in Boston.[13]

In the early 1680s, Phips began to engage in a favorite colonial pastime of treasure hunting in the Bahamas. As captain of the Resolution,[14] he was seeking treasure from sunken Spanish ships near New Providence.[15] The expedition is not well documented but seems to have been profitable, returning shares worth £54 to certain low-level participants. New England mintmaster John Hull was one of Phips's investors.[16] Phips earned a widespread reputation for "continually finding sunken ships".[17]

The strange voyage of HMS Rose of Algeree

Narborough's treasure hunt

On May 2, 1683, the captain of the frigate HMS Falcon was sailing from England to the West Indies and beckoned the other officers to be present as he broke open his secret instructions. He learned that his mission was to aid in the hunt for a large treasure near Hispaniola. A sloop in convoy, HMS Bonetta (sometimes Bonito), was designated to do most of the searching, but Falcon would act as aid and protection. These instructions were from Sir John Narborough, a rear admiral and commissioner of the Royal Navy, who also had the ear of King Charles II.[18]

Agreement between Phips and his crew, drawn up at Whitehall

Around this same time, the thirty-two-year-old Phips had made his way to England, where he gained an audience with Narborough and Charles II. By any measure, this was a remarkable achievement for a poor New Englander like Phips, but it also seems clear that he must have been at the right place at the right time. His reputation for finding sunken ships may have preceded him, and he seems to have had demonstrable gains to show, as one letter writer mentions his "late successful returns." Perhaps he delivered the King's portion of these returns to Whitehall in person.[19] In any case, a reckless plan was concocted, probably by Narborough, whereby this New England native, despite having no background in the English navy, would be assigned as the commander of a 20-gun frigate, HMS Rose of Algiers, for a treasure hunt but given no other financial backing. He and his crew would be required to pay for all other expenses of the voyage, including food and diving equipment, and give a deposit of £100. Of the treasure they found, 35% would go to the King, and the rest would be divided among the otherwise unpaid crew.

The plan seemed ill-conceived and suggests that Narborough was obsessed by the possibility of treasure. It is also possible that Phips was being used in a complex way with the sly intention that HMS Rose would act as a noisy decoy for his more important treasure hunt. Unlike Falcon and Bonetta, Phips was not sent directly to search near Hispaniola where Narborough (correctly) believed a great treasure lay buried. Phips' instructions were not kept secret but were signed by the entire crew, thereby broadcasting their designs through the harbor and shipyards. On July 13, 1683, the articles of agreement (see image) were signed by Phips and seven other crew members, in the presence of Narborough and Haddock.[20]

Delivering Randolph, "Evil Genius of New England"

Before Phips could set sail, he had another mission added to the manifest. Edward Randolph, "indefatigable foe of Puritans",[21][22] was serving Boston with a writ of quo warranto against the precious Charter of Massachusetts and searching for a frigate to be the muscle backing him:

It is essential that a frigate should be on the New England coast at such a time to second the quo warranto and hasten submission; ... a war vessel be present to awe them.[19][23]

Randolph hoped such a display would induce New England to submit to revisions of their charter from the Crown, rather than having it fully revoked. On August 3, 1683, Randolph wrote to Sir Leoline Jenkins, "I am now informed that the H.M.S. Rose is already fitted out for the Bahamas with orders to call at Boston for 2 or 3 weeks on the way."[24] Randolph indicates that time is of the essence, and he is willing to travel with Phips or forego the frigate idea and embark on a merchantman. Randolph, along with his brother Bernard, were given passage and cabins on HMS Rose.

As told by John Knepp

Just before the Rose set sail, things were complicated again when the Crown decided to place a minder on board named John Knepp "to look after the King's interest". Knepp seems to have been a purser.[25] In the English Navy, the purser acted as a sort of Company Store, tempting sailors far from shore with whiskey, tobacco and other desirables by offering them credit against their wages, (collected through the captain). It was a lucrative post and required an investment to procure, hence it usually went to young Naval clerks and scions who could afford the capital outlay.[26] It seems like a terrible idea to place a purser on a voyage like that of the Rose, on a shoestring budget, with the men receiving no wages and collectively buying and sharing food together. Knepp brought great quantities of fancy cheese and brandy, with predictable results. But either way, the purser was dependent on good relations with the captain, yet Knepp seems to have looked down on Phips and decided to be forward in introducing himself to the crew of HMS Rose while Phips was absent in London. The reception was rather less than friendly:

... then most of them began to curse the ship and wished she had been afire before they saw her and that they had better have hired a ship of merchants ...[27]

The crew were a salty bunch to say the least; a "rum lot" as Peter Earle calls them, and this final last-minute bait-and-switch, after the previous addition of Randolph, seems to have nearly put them over the edge. Everything we know about the crew comes from a detailed journal of the trip to Boston was kept by Knepp,[28] and he has rightly been called a "hostile observer",[29] but he was often ignorant of the complex, dual nature of the voyage, as well as basic colonial politics, if not some important elements of human nature. Distant historians must grope for any available source to shed light on events of the past, and so history tends to be swayed heavily by the writers. Phips was never a writer and so much of his story comes from others, with Knepp's Journal at the top of this pile. Like the rest of us, Knepp does not seem to have understood the role Phips was intended to play, either in support of Randolph or as a possible decoy and cleanup for the Falcon & Bonetta.[30] In Knepp's first interaction, he says that he is seeking signatures between the crew and the King though the July 13 agreement (see image) would more accurately be portrayed as between Phips and the crew, as the first mate protests. Knepp's job seemed to be to seek additional signatures from the crew, which is easily done when Phips returns to the ship, with Randolph acting as a witness. Next, Knepp complained to Phips about the firing of the ships cannons to set the watch. By the time the ship set sail the next day, Phips and Knepp were distinctly at odds, as Knepp records when asked for a cabin or berth and was told he would have to make do sleeping on a trunk. This was an unfortunate turn of events for both of them, as well as the historian who would prefer to have Knepp at the Captain's table recording the dinner conversation between Randolph, his brother, and Phips. Class friction surely played a strong role in the conflict between Knepp and Phips. Knepp consistently presents himself as a victim, and there are many times he is bullied and badly mistreated, but it also seems that he must have set himself above and thought of himself as being of a higher class than Phips. The articles of agreement testify to the trust that the King and Narborough placed in Phips, and the crew seemed willing to do as Phips commanded, but Knepp acts as if he is not beholden to Phips. Knepp's journal is addressed to Narborough (and Haddock), and it reads like a sycophant's strong gambit for a future promotion. He presents Phips as the trope of a tarpaulin captain—every sailor his comrade, questionable literacy level—and so it is probably safe to infer that Knepp was of the gentleman class and likely some years younger than Phips, perhaps in his mid-twenties.[26] Knepp is excellent at taking coordinates and seems trained in piloting, but does not exhibit the a breadth of experience or knowledge of the rigging. Though he records every perceived misstep by Phips, his careful plotting of the journey also shows the great ability Phips possessed as a sailor, crossing the Atlantic in half the time of another ship that they meet and making first landfall at Cape Ann.[27]

Randolph arrived at Boston

On October 27, Increase Mather recorded his one and only diary entry for all of 1683: "Randolph arrived at Boston."[31] Phips quickly began to provide a show of force for Randolph by insisting other ships strike their colors and firing across their bows if they did not. Knepp claims that Narborough did not condone this, and many historians have followed his lead in treating Phips' activities in Boston harbor as arrogant showboating, but it seems clear from the letters of Randolph and Blathwayt[32][Note 2] that Phips was not doing this merely for some explosive fun. Phips cites personal instructions from the King, and indeed Charles II was known to have insisted on a salute to his flag.[33] As Phips was creating chaos for the Massachusetts government, he continued to pursue his original intention of gathering diving equipment and divers to take to the Bahamas. Phips later followed the same procedures of requiring ships to strike in the West Indies and with a new crew in Bermuda. Phips lack of experience in the Royal Navy would suggest he likely made mistakes and did not always go about this procedure in the best way. It must have been a strange and uncomfortable chore for someone whose loyalties were with Boston (in '76 the records show initiated the building of a house in Boston).[8][Note 3] Randolph was never one to withhold criticism, but he did not complain of Phips activities in Boston harbor that winter,[29] and Randolph even seems to have assisted Phips by searching a ship for him. But choosing a threatening posture showed Randolph's inability to understand the New England character, and it did not produce the effect Randolph intended. The magistrates voted to submit to the crown, but the deputies resisted. Phips and the Rose became a focal point for the resistance, as Knepp dutifully recorded without understanding the subtext: "Phips crew say that they would as soon fire against this town as against Algiers and called us rebels," is one deposition Knepp records though Knepp seems to believe he is merely recording a barroom brawl. " ... one of the constables in particular told him that he thought Capt. Phips had been a town born child, Captain Phips answering him, 'Let him be what he would, he had been sworn at sixteen years of age to be true to the King and his government." (As if in an act of delayed vengeance, HMS Rose would be boarded and demasted, and its captain John George imprisoned, less than six years later during the Boston revolt.)[34]

Randolph's writ of quo warranto required a response from Massachusetts by the end of "Michaelmas term." Empty-handed, Randolph and his brother boarded a pink bound for England on December 14. A few days later, Phips began making preparations but was detained by problems with the Boston government and the ongoing search for victuals.[28] In a discussion with Phips, Knepp allows, as a purser, that many of the crew owe him money and says that he would have them thrown into jail except that it would hinder His Majesty's treasure hunt. Phips finally sailed clear of the Boston Harbor on January 19, 1684[35] but unfortunately not before some of his rogue-ish crew could cause a small riot in Boston and perpetrate a despicable assault in Hull, according to Knepp.[36] Knepp was not on board, meaning he had effectively deserted according to the Articles, "though I should be almost undone by it" and so it became all the more important for Knepp to show Phips in a bad light.

Two days after Phips left the Boston area, Increase Mather gave a rousing speech to the deputies and freemen advising them not to submit to the Crown and to resist the quo warranto. One historian calls this Increase Mather's "first important entry into politics."[21] {Mather's "Remarkable Providences" was distributed this same month, with echoes to the New England government Increase Mather assembles in 1692.} It had been Phips' debut into colonial politics too, if clumsily and involuntarily. To what extent he was swayed by the arguments of Randolph as they crossed the Atlantic, it is hard to know, but Phips certainly played the role with bluster, and he seems to have spoken up as a royalist to the Boston government in the meetings he had with Bradstreet and Stoughton, at least as recorded by Knepp. By 1688, Phips had crossed over to Increase Mather's side and begun to consistently oppose Randolph and the Dominion government he helped bring about and with a vehemence that would seem to suggest some degree of shame and dismay for the role he played as Captain of HMS Rose in 1683–84.

1684 Map Drawn by Charles Salmon

After leaving Boston, Phips searched the picked over wrecks in the Bahamas with limited success. Too many other treasure hunters had already gone before. When some of his crew became mutinous, he had them put off in Jamaica. On November 18, 1684, Phips was in Port Royal, Jamaica, the same time as Captain Stanley of the Bonetta.[37] There is no record of their joining forces or sharing information. It seems likely they met up, but it is unknown if it was preordained. If Phips was unwittingly being used as a decoy to distract the other treasure hunters away from Stanley, it might have dawned on him at this time. Soon afterward, Phips visited the north coast of Hispaniola and slowly cruised north exploring the banks where Stanley had been diligently searching for over a year. The decisiveness with which Phips later returned and quickly located the treasure suggests that he was able to gather valuable knowledge and began to formulate a clear plan, though he would have to wait two years to bring it to fruition.

After Phips returned to London in August 1685, Samuel Pepys ordered the Navy Board to assess the Rose. Pepys had been out of power when Narborough set the strange plan in motion. In March and May 1686, Phips was ordered to attend the Lord Treasurer, where it was found that the king was only to receive £471 in treasure, though the wear and tear on the Rose was estimated at £700.[38] In this age of piracy and high mortality, Phips making it back to London alive and with the King's ship still afloat was probably enough for him to pass the test. Already Narborough had a new plan in the works for Captain Phips, though this time it would be a private venture. Narborough's long infatuation with the Hispaniola treasure had not been diminished by Captain Stanley's discouragement on the Bonetta. And Knepp's report on Phips did not disqualify him. Phips had shown that he was serviceable: willing to harass the harbor of his hometown and to compromise between his own interests and the interests of the Crown. This was surely noted at Whitehall, even by the more conservative elements.

Striking silver and gold

With Captain Stanley of the Bonetta expressing disinterest in continuing to search for the Hispaniola treasure, while Captain Phips probably expressed enthusiasm and new confidence, the next logical choice for commander was obvious. Narborough turned to the hard-partying Duke of Albemarle who assembled a group of private investors to fund another expedition. Phips was tasked with finding suitable ships and these came to be the James and Mary, a 22-gun 200-ton frigate, and the 45-ton Henry of London, a sloop commanded by Francis Rogers,[39] Phips' second mate on the previous voyage (he had left the Rose in Boston ISTG Vol 4 - Salee Rose). Phips utilized experience as a sailor and shipwright to select high quality anchors, chains, and cables to hold their ships securely in close proximity to the shoals for months as they tried to fish treasure from it. £500 worth of merchandize was taken along to barter for provisions, as well as to provide cover, or a ruse, that they were in Hispaniola merely as merchants, not treasure hunters. The London investors must have felt confident because they paid a total of £3,210 outfitting the ships for the voyage.[40] Unlike the voyage of the Rose, the crew were to be paid regular wages.

Engraving depicting Phips raising the sunken treasure

Phips sailed from the Downs on September 12, 1686, and on November 28, arrived in Hispaniola, Samana Bay, where they spent two weeks restocking their water and provender. The weather was bad, and the search consequently did not get underway for a few more weeks. On January 12, Phips sent out Captain Rogers in the smaller Henry of London along with three Native American divers (including Jonas Abimeleck and John Pasqua; the name of the other diver is not listed) to search what was then called the Ambrosia Bank (now the Silver Bank). There was a bit more delay due to the weather, but Peter Earle writes, "There is no doubt that he knew exactly where he was going." On January 20, they spotted cannons from a shipwreck lying on the white sands of the reef. The ship they had found was the Almiranta of the Spanish silver fleet (later determined to be Nuestra Señora de la Concepción; the English did not know the name of the ship) wrecked in 1641.[41] Over the next two days, the divers were able to bring up 3,000 coins and 3 silver bars. They decided to travel back to Phips to let him know, but this turned out to be a somewhat slow and treacherous trip among the reefs.

After Phips was discreetly informed of their amazing find, he spent the next nine days preparing the ships and gathering enough food to sustain the men over months of bringing up treasure.[42] (During the controversies that surrounded Phips at the end of his life, his critics like to portray him as hot-headed, ill-bred, and impatient, so it seems worth noting his careful conduct during this life-changing and momentous time.)

Through March and April, the divers and ships' crews worked to recover all manner of treasure: silver coins, silver bullion, doubloons, jewelry, a small amount of gold, and other artifacts. Concerned about the possibility of mutiny, Phips guaranteed to the crew, who had been hired for seaman's wages, that they would receive shares in the find even if he had to pay them from his own percentage.[43] He carefully avoided putting in at any ports before anchoring at Gravesend, where he dispatched a courier to London with the news.

The treasure weighed in at over 34 tons, or £205,536. Almost a quarter went to Albemarle.[44] Phips, after paying out £8,000 in crew shares, received £11,000.[45] Phips was treated as a hero in London, and the find was the talk of the town.[46] Some economic historians argue that Phips' find significantly affected history, because it led to a major increase in the formation of joint-stock companies and even played a role in the eventual formation of the Bank of England.[45]

Phips and the crew were rewarded by the investors with medals, and Phips was knighted by James in June. James also rewarded Phips with the post of Provost Marshal General (Chief Sheriff) of the Dominion of New England, serving under Sir Edmund Andros.[47] In September 1687, Phips returned to the wreck, though he did not command the venture. Admiral Narborough elected to personally lead the expedition, but it was not nearly as successful. The wreck had been discovered by others, and the arrival of the English scattered more than 20 smaller ships. Treasure worth £10,000 was recovered before Narborough's death in May 1688 brought the expedition to an end. Phips had by then already left the wreck site in early May, sailing for Boston for what seems to have been his first time home in four and a half years, to take up his new post as Provost Marshal General.[48]

Provost Marshal General

Phips arrived back in Boston in the summer of 1688 and was welcomed back as a hero. His wife seemed very happy to see him.[16] He was celebrated in sermons and at the Harvard College commencement he was compared to Jason fetching the Golden Fleece.[16] Andros and Randolph were not so happy to see him, and it seems the feeling was mutual. Almost all of New England was unified in their opposition to Andros and Randolph. Phips, despite having been Captain of Randolph's gunship in 1683-4, does not seem to have carried an association with Randolph in the minds of the people of Massachusetts Bay.

Andros swore Phips into his new post in early July, but his council refused Phips' demand that the previously named sheriffs be dismissed. If Phips had simply wanted a share in the spoils of the Dominion, he might have stuck around and kept his head down. Instead, he stayed home in Boston only six weeks before shipping back to London to join with Increase Mather in opposing the Dominion and seeking to restore the original charter. This seems to be the first mention of Phips in Increase Mather's diary or correspondence.[21] Motivated by a shared dislike of Andros, Phips and Increase Mather worked together to bring about his downfall. After the Glorious Revolution in late 1688 replaced the Catholic James with the Protestant monarchs William III and Mary II, Phips and Mather petitioned the new monarchs for restoration of the Massachusetts charter[49] and successfully convinced the Lords of Trade to delay the transmission of formal instructions about the change of power to Andros. Phips returned to Boston in May 1689, carrying proclamations from the King and Queen and found Andros and Randolph had already been arrested in a revolt in Boston.[50] Phips served for a time as an Overseer guarding Andros and Randolph in the prison at Castle Island.[51]

Becoming free: The political baptism of Phips

If Paris were worth a mass to Henry IV, Boston was worth a conversion, in the Puritan sense, to William Phips.[52]

The turmoil in England and William's accession to the throne had prompted New France's Governor to take advantage of the political turmoil in New England, launching a series of Indian raids across the northern frontier in 1689 and early 1690.[53] When a frontier town in Maine was overrun in early March 1690, the French were perceived as instigators and the provisional government of Massachusetts began casting about for a major general to lead an expedition against the French in Acadia. Phips had not demonstrated military interests as a young man. During King Philip's War, when many took up arms, Phips built ships and cut lumber. John Knepp's journal testifies to Phips' constitutional disinterest in military discipline.[27] Yet Phips' control of a naval gunship, and his subsequent actions, seem to have suggested he was a good candidate to lead a large military expedition. Sewall writes:

Saturday, March 22. Sir William Phips offers himself to go in person, the Governor [Bradstreet] sends for me, and tells me of it, I tell the [General] Court; they send for Sir William who accepts to go, and is appointed to command the forces. Major Townsend relinquishes with thanks. Sir William had been sent to at first; but some feared he would not go; others thought his Lady would not consent. Court makes Sir William free and swear him Major General, and several others. Adjourn to Boston, Wednesday,14 night one o'clock.[16]

This is Sewall's entire entry, and he has no entry for the next day. It shows that Phips, though knighted, one of the richest men in the colony, and highly active on the colony's behalf, was not yet able to vote or serve under the provisional government because they were following the old charter, wherein only church members were free. The court, not the church, made Phips free on this Saturday, according to Sewall. Sewall was religiously devout and active in his church congregation and would not likely have misspoken or deliberately withheld information on this point. Sewall's diary is generally considered trustworthy and is widely referenced by historians.

Phips added to the rolls of the North church. MHS with permission.

Some years later, after Phips' death and a good bit of political upheaval involving Phips and the Mathers, Cotton Mather anonymously wrote a biography of Phips and sent it away to London for publication although he had Boston printing presses at his beck and call.[54] He implausibly cast this scenario as a spontaneous spiritual awakening, including heartfelt testimony, which Cotton Mather claims to faithfully transcribe "without adding so much as one word unto it."[55] (Cotton Mather loved puns and inside jokes, which could be interpreted as his sly way of saying Phips wrote not a single word.)

Both events are not mutually exclusive. Cotton Mather places the baptism the next day, March 23. The general court in which Cotton Mather played an active role may have made Phips free with the understanding that Cotton Mather would add him to the rolls of the North Church. Records of the North Church show Phips' name added to admissions. (Curiously, a "B" for "brother" is withheld as prefix to his name, unlike all others. See image.) Another book, mostly recording infant baptisms, lists Phips as "Admitted and Baptized." Phip's wife's name does not seems not to appear in the records at all. The admission and baptism of an adult was generally a somewhat drawn-out process over some weeks.[56] There seems to be no surviving record of Phips "coming to the table" to partake in the Lord's Supper, as only church members were invited to do.

The only other reference to a baptism of Phips is not first-hand but a sardonic reference by Blathwayt (Randolph's boss in London) mentioning Phips being made a general the same year he was "publicly christened at Boston."[57] Expanding the franchise of New England away from the control of the clergy was one of Blathwayt's obsessions, and his comment probably goes to this point, as well as noting Phips loyalty with New England as opposed to the crown.[58] In short, if something like Cotton Mather's March 23 church scene happened at all, it should be understood as foremost a political event.

Major General

Port Royal expedition

In late April, leading a fleet of seven ships and over 700 men, Phips sailed from Boston[59] to the Acadian capital, Port Royal. On May 9 he summoned Governor Louis-Alexandre des Friches de Meneval to surrender.[60] Meneval, in command of about 70 men and a fort in disrepair, promptly negotiated terms of capitulation. When Phips came ashore the next day, it was discovered that Acadians had been removing valuables, including some that were government property (and thus were supposed to come under the victor's control).[61]

Phips, whose motives continue to be debated by historians today,[Note 4] claimed this was a violation of the terms of capitulation and consequently declared the agreement void. He allowed his troops to sack the town and destroy the church, acts that he had promised to prevent in the oral surrender agreement.[62] He had the fortifications destroyed, removing all of their weaponry. Before he left, he convinced a number of Acadians to swear oaths of allegiance to the English Crown, appointed a council of locals to administer the town, and then sailed back to Boston, carrying Meneval and his garrison as prisoners of war. Phips received a hero's welcome and was lavished with praise, although he was criticized in some circles (and has been vilified in French and Acadian histories)[63] for allowing the sacking of Port Royal.[64]

Quebec expedition

French drawing showing the English attack on Quebec
Frontenac receiving the envoy of Sir William Phips demanding the surrender of Quebec, 1690.

In the wake of the success, the Massachusetts provisional government agreed to organize an expedition on a larger scale against Quebec, the capital of New France, and gave its command to Phips. Originally intending to coordinate with a simultaneous overland attack on Montreal launched from Albany, New York, the expedition's departure was delayed in the vain hope that needed munitions would arrive from England. The expedition, counting 34 ships and more than 2,000 soldiers, finally sailed on August 20. It was short on ammunition, had no pilots familiar with the Saint Lawrence River, and carried what would turn out to be inadequate provisions.[65]

Because of contrary winds and the difficulty in navigating the Saint Lawrence, the expedition took eight weeks to reach Quebec.[66] The late arrival (wintry conditions were already setting in on the river) and the long voyage meant that it would be impossible to conduct a lengthy siege. Phips sent a message into the citadel demanding its surrender. Governor General Louis de Buade de Frontenac declared that his only response would be from "the mouths of my cannons".[65] Phips then held a war council, which decided to make a combined land assault and naval bombardment.[66] Both failed. The landing force, 1,200 men led by Major John Walley, were unable to cross the well-defended Saint-Charles River, and the naval bombardment failed because the New Englanders' guns were unable to reach the high battlements of the city, and they furthermore soon ran out of ammunition. The fighting, according to Phips, cost the expedition 30 deaths and one field cannon, as well as numerous wounded; disease and disaster took an additional toll. Smallpox ravaged the troops, and two transports were lost to accidents; another 200 men were lost to these causes.[67]

Sir William Phips in later life

The expedition cost the colony £50,000 to mount, for which it issued paper currency, a first in the English colonies.[68] Many of the expedition's participants and creditors were unhappy at being paid this way, and Phips generously purchased some of the depreciated paper with hard currency, incurring financial losses in the process. At this same time, Governor Meneval petitioned for the return of minor valuables (silverware and other small items) that Phips had taken.[52] Phips was outraged when the General Council heard Meneval's case. He returned to England in February 1691 to seek support for another expedition against Quebec.[16]

Governor of Massachusetts

Soon after returning to England, Phips joined up again with Increase Mather, and again supported him in dealing with Whitehall. Increase Mather's diary says they are together on March 25, 1691, and again on March 26.[69] On March 31, they are together as Increase Mather writes a response to the Board of Trade. Also at this meeting is Sir Henry Ashurst. These three—Mather the clergyman, flanked by two knights: Sir William Phips and Sir Henry Ashurst—would emerge later as the major proponents of the various compromises that brought about a new charter. Not counting Phips, there seem to have been a total of four agents acting on behalf of Massachusetts in seeking to restore the old charter. The two agents holding official commission papers from the Massachusetts council—Cooke and Oakes—were also the least compromising and the least politically deft. The Board of Trade seems to have sought a policy of pushing through a new charter by cleaving the two knights away from these two agents. On July 24, Increase Mather recorded in his diary that he would "part with my life sooner than [compromise on charter]". Not long after this, Increase Mather left London on vacation. On August 11, 1691, a letter was written from Whitehall to King William's secretary: "I must now desire your Lordship to acquaint the King that they are willing to accept their Charter ... and no longer Insist upon the Alterations mentioned ... "[69][70] This could not have been Cooke and Oakes because they never wavered in their stance opposing a new charter. Mather's diary entry one week later (August 19) indicates that he is still either unaware or has not yet accepted this move. On August 20, the Earl of Nottingham told a committee that he had been with Sir William Phips, who informed him that the New England agents "did acquiesce therein [with the new charter]." By August 27, Increase Mather had decided to participate in the process of shaping this new charter, if reluctantly.[69]

A number of Mather's requests concerning the new charter were rejected, but William and Mary allowed Mather to nominate the colony's lieutenant governor and council members.[69] The monarchs appointed Phips as the first Royal Governor, with Increase Mather's approval, under a newly issued colonial charter for the Province of Massachusetts Bay.[69][71] The charter greatly expanded the colony's bounds, including not just the territories of the Massachusetts Bay Colony but also those of the Plymouth Colony, islands south of Cape Cod including Martha's Vineyard and Nantucket, and the present-day territories of Maine, New Brunswick, and Nova Scotia.[72] It also expanded the franchise to be nearly universal (for males).[69]

Phips and Increase Mather were odd fellows, without much in common, but they had become politically conjoined to the new charter, and it would be their job to sell it to the people of Massachusetts, who were expecting their agents to return with nothing less than the old charter restored.

Salem witch trials

Phips and Increase Mather reached Boston in separate ships on May 14, 1692. This was a Saturday afternoon, meaning all activity was to cease at sundown according to the old Puritan laws regarding the sabbath. Unlike his arrival in HMS Rose in 1683, when Phips showed little regard for the sabbath, on this occasion, Phips was highly deferential toward the theocracy. Phips's elaborate swearing-in ceremony at the meeting house was halted at sundown and delayed until the following Monday. According to one letter writer, Phips presented himself as having no intentions to oppose the ancient laws and customs of Puritan Boston. He promised to rule as a weak governor, according to the tradition of his predecessors.[73] The speech itself had likely been crafted with the care and attention of Increase Mather as they crossed the Atlantic. They seemed to have come to an agreement—you work your side of the street and I'll work mine—whereby Phips would tend to the frontier while Increase Mather and his slate of cohorts would see to domestic affairs.

Unfortunately, their crossing also coincided with the great swelling of the infamous witchcraft hysteria. More than 125 people had been arrested on charges of witchcraft and were being held in Boston and Salem prisons. On May 27, a special Court of Oyer and Terminer was created to hear the accumulated cases. This may have been Increase Mather's idea since such courts were specifically mentioned in the new charter and no one had spent more time working on the details of the charter than Increase Mather.[74] Nonetheless, Phips signed the order and may have composed it. The language of the order itself is curious because it speaks of concern for the welfare of those "imprisoned during this hot time of the year". Increase Mather's pick for lieutenant governor, William Stoughton, was chosen as chief judge of this new court.[75] There was little then to indicate that Stoughton would proceed with such ruthless conviction. Phips later claimed to have chosen nominations for the court from "persons of the best prudence and figure that could then be pitched upon",[76] and indeed, as Thomas Brattle pointed out, most were well-known and respected merchants from the Boston area.

On June 8, William Stoughton ordered a woman accused of witchcraft (Bridget Bishop) to be executed only two days later, though tradition had been to allow at least four days between order and execution. The following Monday, the clergy all around the Boston area were asked to officially weigh in on the issue. There is no official record of this meeting except what was written down by Increase Mather's son Cotton Mather and usually referred to as The Return of the Ministers, which was put into print at the end of 1692 in a book by Increase Mather, after Phips's had disrupted the trials and disbanded the Court of Oyer and Terminer. The manuscript was unknown to historians until 1943, when it was presented to archivists in a trove of documents including the infamous Letter from Cotton Mather to William Stoughton, September 2, 1692. Cotton Mather's manuscript is carefully scribed with few cross-outs or mistakes, suggesting it was not so much "minutes" of a meeting as a careful construction after the fact. It is not endorsed by any minister or government official. According to Cotton Mather's telling, the ministers at the gathering simultaneously urged both caution and speedy prosecution. Most importantly, Cotton Mather's Return does not disallow, or discredit, the admission of spectral evidence (accusations of a crime committed by one's "specter", against which there is no alibi possible). The Mathers, father and son, continued to debate this issue with other area ministers, like Samuel Willard, throughout the summer and into the fall, as documented by the minutes of the Cambridge Association.

At the end of June, five more women were condemned to die. Phips granted a reprieve to one of these but was impressed upon "by some Salem gentlemen" to take it back.[77] At this point, Phips seemed to wash his hands of the proceedings, not relishing the idea of gaining the enmity of his own lieutenant governor and powerful clergymen, including the fully committed Cotton Mather[78] and the somewhat more waffling Increase Mather. There is no record of Phips ever having traveled north to meet any of the "afflicted" or attend a single Oyer and Terminer trial or execution. Instead, Phips continued to work on recruiting troops and gathering supplies to build a fort in Maine, and he left the province around August 1 and was gone the entire month and much of September. William Stoughton seems to have officially taken over executive powers in this period of Phips's absence.[79]

Postcard showing a 1909 reproduction of Fort William Henry

French and Indian raids had resumed in the years following Phips's 1690 expeditions, so he sought to improve the province's defenses. Pursuant to his instructions from London, in 1692, he oversaw the construction of a stone fort, which was dubbed Fort William Henry, at Pemaquid (present-day Bristol, Maine), where a wooden fort had been destroyed in 1689. He recruited Major Benjamin Church to lead a 450-man expedition eventually leading to a tenuous peace agreement with the Abenaki people.[citation needed]

By the time Phips returned from Maine on September 29, 1692, twenty people had been executed and the accusations and arrests continued, including charges against many high-profile individuals, allegedly including Phips's own wife. At this point, Phips finally let it be known that the Court of Oyer and Terminer "must fall".[citation needed] A new court was formed with instructions to entirely disregard spectral evidence. But Stoughton was once again selected by his peers to be chief justice. In late January 1693, Stoughton ordered eight graves dug in advance of his next round of execution orders, not realizing that Phips would no longer appease him.[citation needed]

All eight were cleared by Phips's proclamations, leading Stoughton to storm from the court. His replacement on the court was more inclined to mercy for the accused. Beginning in February 1693, no more of the accused were condemned to die, and almost all had been released from prison by May.[citation needed]

Recall to London

Phips' leadership was dependent on the support of the powerful Mather's, father and son, as well as their pick to be his lieutenant governor. This strange and disparate coalition had been badly fractured by the witchcraft proceedings, and Phips' resolute and final, if slow, move to shut it down. In a letter written October 20, 1692, Cotton Mather expressed anguish over the ending of the "proceedings" and stated his displeasure with his father's recent call for presumed innocence ("Cases of Conscience"). When Phips stood up to Stoughton, he gained a terrible foe. Furthermore, Joseph Dudley, a Massachusetts native (and former Dominion official alongside Randolph) was in London, scheming to replace Phips, and in early 1693 Stoughton joined forces with him.[80]

The strain of this seems to have gotten to Phips in a way that so many previous seemingly insurmountable challenges had not. In January 1693, Phips was involved in an embarrassing and unseemly physical altercation with his subordinate captain in the royal navy, Richard Short. Their accusations against each other in letters to Whitehall[81] follow the standard lines of the Tarpaulin vs. Gentleman.[26] Short is called a drunk, corrupt, unwilling to withstand hardships, or obey direct orders. His lieutenant captain is accused of cowardice. Phips, as usual, is accused of having only a carpenter's education, poor manners, and disregarding standard procedure (reminiscent of the journal of Knepp). Phips' pick for a replacement captain, Dobbins, is accused of the same. Phips is also accused of corruption, which was a standard charge, and a standard problem for colonial leadership at this time. But Phips, having traded silver for paper after the fiasco of Quebec, and building his own ship to chase pirates in Maine, seems to take the teeth out of this accusation.

Following the Dominion government, in which Andros oversaw all of the colonies, there was a good bit of jealousy, border disputes, and jockeying for position between the new governors of the various colonies, and Phips seems to have done as much to inflame these jealousies as to work past them. Phips expressed outrage at the execution of Leisler and harbored enemies of Fletcher[52] and the New York government that replaced Leisler. Phips' ongoing struggles with Usher in New Hampshire continued as before. (In 1695, following Phips' death, Bellomont was placed over Fletcher, Usher, and Stoughton, suggesting Whitehall was unimpressed by the bickering of the three provinces and not swayed by the particular merits of any of their arguments. Bellomont ordered a posthumous pardon of Leisler.)

Keeping up the longstanding tradition of Massachusetts Bay, Phips fought against the office of custom inspectors, arguing that the port of Massachusetts did not see enough enumerated goods to warrant their presence. Instead Phips attempted to re-establish a naval office, with himself acting as head of the admiralty, thereby doling out favors to gain the support of the powerful merchant class. This was part of an old turf battle between the Admiralty and Customs, but it led to an altercation with Randolph's custom inspector, Jahleel Brenton, which seemed to follow the similar embarrassing and unseemly pattern as his altercation with Captain Short. The two altercations weighed together against Phips. Phips was accused of violating the Navigation Acts, as his predecessor had been. Blathwayt was slowly and steadily working to standardize the flow of tributes from the colonies to the Crown, and if Phips was clogging these pipes, he would need to answer for it.

By the spring elections of 1693, Phips needed new connections to balance against the dangerous enmity of Stoughton. Elisha Cooke was elected, and Phips negated his seat. For a royally appointed governor to exercise such veto power, granted only by the controversial new charter, was a highly unpopular move and could establish a dangerous precedent. Increase Mather had fought unsuccessfully to keep this veto power out of the new charter, but ironically, he seems to have been the architect of this move.[82] A few weeks later, Phips invited both men to dinner but was unable to broker a truce. Phips was still trying to maintain a bond of loyalty to Increase Mather. By many counts this move against Cooke was considered poor political calculus. The Mathers, father and son, were a house divided, trying to heal itself.[83] The Mathers had lost much credibility and public trust. Phips seemed slow to realize that Increase Mather should no longer be his trusted adviser. A year later, when Elisha Cooke was again elected, Phips allowed it to stand. But by this time, it was probably too little, too late.

On July 31, 1693, Phips hosted at his house a meeting of the General Council, including Stoughton and four other O&T judges, and read a letter that had arrived the day before from the Queen. The letter supported Phips in his ending of the trials and stated that "the greatest moderation and all due circumspection be used..[toward those accused of witchcraft]." No doubt Phips wanted the letter read into the official minutes, but by hosting the meeting at his house, one wonders if he was not trying to provoke, especially if his own wife had been among the accused.

On November 30, 1693, little over a year after Phips had shut down the Court of Oyer and Terminer, Whitehall heard complaints against Phips regarding Short and Brenton, shepherded to London by Stoughton and Dudley. A recall with the internal date of February 15, 1694, summoned Phips back to London to answer the charges. It took months for the letter to reach Boston. On July 4, 1694, Phips received the summons to appear before the Lords of Trade. Stoughton, of all people, was ordered to oversee the gathering of evidence for the hearing, a galling reversal of fortunes for Phips. Phips spent much of the summer in Maine, at Pemaquid, securing a peace treaty and overseeing the frontier defenses near his birthplace.

Phips finally sailed for England on November 17. Increase Mather was asked to go along in support but decided against it, citing the difficulty of the journey, though his diary from the time is full of yearning to return to England. They were still friendly, but it seems their coalition and partnership was in tatters.

As a final stroke, before Phips left, he pardoned all those who had been accused of witchcraft.[84] Most had already been reprieved, but a pardon ensured they would not be brought to trial in his absence. He sailed from the harbor after sunset on the sabbath, firing guns from his ship. Samuel Sewall notes the similarity to his "uncomfortable" time of arrival, but the differences are more telling. Phips was no longer sensitive to the customs of the Puritan clergy, he was loudly defying them.

Phips arrived in London in early January, 1695. Upon his arrival in London, he was arrested on exaggerated charges, levied by Dudley, that he had conspired to withhold customs monies. Phips was bailed out by Sir Henry Ashurst but fell ill with a fever[citation needed] and died on February 18, 1695,[2] aged 44, before his charges were heard. He was buried in London at the Church of St. Mary Woolnoth.

Family and legacy

William and Mary Phips had no children. They adopted Spencer Bennett, the son of Mary's sister Rebecca,[85] who formally took the Phips name in 1716.[86] He went on to serve as Lieutenant Governor of Massachusetts, including two periods as acting governor.[87]

Cotton Mather's anonymous Life of Phips

Phippsburg, Maine, is named in his honor.[88][89]

Notes

  1. ^ All dates are Julian calendar, as recorded at the time, except that each new year is begun on January 1 (as opposed to March 25). Orthography is also updated for clarity.
  2. ^ Ann Jacobsen's biography of Blathwayt also points to this.
  3. ^ Letters of Randolph are now freely available online in various forms and can usually arranged by date.
  4. ^ Griffiths (2005), p. 151 provides several competing points of view on the matter.

References

  1. ^ a b Lounsberry (1941), pp. 8–11
  2. ^ a b Chu (2000)
  3. ^ Baker & Reid (1998), p. 10
  4. ^ Baker & Reid (1998), p. 5
  5. ^ Calef, Robert (1700). More Wonders of the Invisible World. Public Domain: Nathaniel Hillar at the Prince's Arms. pp. Postscript, 145.
  6. ^ Baker & Reid (1998), p. 21
  7. ^ Lounsberry (1941), p. 16
  8. ^ a b Baker & Reid (1998), p. 15
  9. ^ Baker & Reid (1998), p. 16
  10. ^ Baker & Reid (1998), p. 17
  11. ^ Lounsberry (1941), p. 22
  12. ^ Lounsberry (1941), p. 23
  13. ^ Lounsberry (1941), pp. 24–26
  14. ^ Baker & Reid (1998), pp. 26–27
  15. ^ Earle, Peter (1979). The Treasure of the Concepcion. New York: The Viking Press. p. 125.
  16. ^ a b c d e Diary of Samuel Sewall" Vol. I 1674–1700, Vol II 1700–1729 MHS Collections Vol. V-VI Fifth Series, Boston MA 1878. Public Domain. Happy wife is June, 1688. Golden Fleece is July, 1688. Becoming free in 1691 and bold emphasis is mine.
  17. ^ Earle (1979) p. 125. Earle's citation is from the Archivo General de Indias, Seville.
  18. ^ Peter Earle (1979) pp. 122–125.
  19. ^ a b Randolph to Sir Leoline Jenkins July 26, 1683, in British History Online
  20. ^ Karraker, Cyrus H. (1932-10-01). "The Treasure Expedition of Captain William Phips to the Bahama Banks". The New England Quarterly. 5 (4): 731–752. doi:10.2307/359331. JSTOR 359331.
  21. ^ a b c Murdock, Kenneth B. (1925). Increase Mather. Cambridge, MA: Harvard University Press. pp. 152–154.
  22. ^ Washburn, Emory (1840). Sketches of the Judicial History of Massachusetts. Boston, MA: Little and Brown. Public Domain. p. 121.
  23. ^ "[Randolph] clamored for a ship, preferably a ship of war to give the business prestige."Michael G. Hall Edward Randolph and the American Colonies (1960) pp. 79–81.
  24. ^ Eward Randolph to Sir Leoline Jenkins, British History Online, August 3,1683.
  25. ^ Baker & Reid (1998) p. 30
  26. ^ a b c Davies, J.D. (1991). Gentlemen and Tarpaulins: The Officers and Men of the Restoration Navy. New York: Oxford. pp. 16–21 passim.
  27. ^ a b c MHS holds a copy of John Knepp Journal in the F.L. Gay Collection. It remains unpublished but is available for public viewing in their reading room.
  28. ^ a b John Knepp at MHS & F.L. Gay "A Rough List of a Collection of Transcripts"
  29. ^ a b Baker & Reid (1998), p. 32
  30. ^ Peter Earle (1979), pp. 126–127.
  31. ^ Diary by Increase Mather. 1674–1687. Cambridge MA. University Press. 1900. p. 51 or search by date.
  32. ^ British History online search Blathwayt and July 1683.
  33. ^ Davies (1991) p. 64
  34. ^ Hall (1960), See index under "Rose" or "Phips"
  35. ^ Lounsberry (1941), p. 85
  36. ^ Baker & Reid (1998), pp. 41–43
  37. ^ Earle, Peter (1979) p. 154
  38. ^ Earle (1979) p. 158
  39. ^ Earle (1979) p. 160-167
  40. ^ Earle (1979) p. 165-7
  41. ^ Fine (2006), pp. 48–52
  42. ^ Earle (1979) p. 181
  43. ^ Lounsberry (1941), p. 140
  44. ^ Earle (1979) p. 201
  45. ^ a b Baker & Reid (1998), p. 54
  46. ^ Lounsberry (1941), p. 147
  47. ^ Baker & Reid (1998), pp. 55–58
  48. ^ Baker & Reid (1998), pp. 59–63
  49. ^ Diary of Increase Mather (MHS & AAS). August 1688 entry contains I.M.'s first mention of Phips, as the two of them begin working together on behalf of Massachusetts in London. They would continue to work together for the next 4 years. Also see F.L. Gay, ''Rough List of the Collection" available online.
  50. ^ Baker & Reid (1998), pp. 69–74
  51. ^ Lounsberry (1941), p. 200
  52. ^ a b c Barnes, Viola F. (1928-07-01). "The Rise of William Phips". The New England Quarterly. 1 (3): 271–294. doi:10.2307/359875. JSTOR 359875.
  53. ^ Griffiths (2005), p. 190
  54. ^ Calef, Robert (1700). More Wonders of the Invisible World. London: Public Domain. Online. BPL. pp. see postscript regarding Cotton Mather's "Life of Phips".
  55. ^ Pietas in Patriam. Life of His Excellency Sir William Phips. Dedicated to the Earl of Bellomont. London 1697. Anonymously published but later owned by Cotton Mather and included in his Magnalia.
  56. ^ See Upham Vol I and II for detailed descriptions of Parris admitting new members.
  57. ^ Calendar of State Papers Domestic Series of the reign of William and Mary. Vol I-III. Preserved in the Public Record Office (PRO). London. Available online. Sir Francis speaks of need for masts is July 1692. For Blathwayt on Phips christening see March 6, 1691.
  58. ^ British History online, 1691, search Blathwayt and "baptised"
  59. ^ Lounsberry (1941), p. 210
  60. ^ Faragher (2005), p. 87
  61. ^ Griffiths (2005), p. 151
  62. ^ Faragher (2005), p. 88
  63. ^ See e.g. Faragher (2005), p. 88
  64. ^ Lounsberry (1941), p. 213
  65. ^ a b "Biography of Sir William Phips". Dictionary of Canadian Biography Online. Retrieved 2011-05-03.
  66. ^ a b Peckham (1964), p. 36
  67. ^ Peckham (1964), p. 37
  68. ^ Peckham (1964), p. 38
  69. ^ a b c d e f The Glorious Revolution in Massachusetts, Selected Documents 1689–1692, pp. 544–624. The documents are in chronological order.
  70. ^ Baker & Reid (1998), pp. 206–210
  71. ^ Lounsberry (1941), p. 245
  72. ^ Lounsberry (1941), p. 252
  73. ^ Calendar of State Papers Colonial, America and West Indies, London, 1901. Now also found online at British History online. Letter-writer is Joshua Broadbent, June 21, 1692.
  74. ^ Moody, Robert Earle, ed. (1988). The Glorious Revolution in Massachusetts 1689–1692. Virginia: Colonial Society of Massachusetts. p. 612 Note: some activités of Phips are omitted but the industriousness of Increase Mather is very well-documented.
  75. ^ Hart (1927), 2: 41
  76. ^ Calendar of State Papers (1901) and British History online, see October 12, 1692.
  77. ^ Calef, Robert (1700) Public Domain, many editions available with different pagination. Search for Rebecca Nurse.
  78. ^ See 1692 private letters from Cotton Mather to various correspondents August 5, September 2, September 22, and October 20.
  79. ^ Moore, George H. (1888). Bibliographical Notes on Witchcraft in Massachusetts. Worcester, MA: American Antiquarian Society, Public Domain. p. 9: Moore lists Phips as having been present at General Council (not O&T) meetings on June 13, 18; July 4, 8, 15, 18, 21–22, 25–26; September 5, 12, 16; October 14, 22, 26.
  80. ^ Kimball (1911), p. 66
  81. ^ Calendar (1901) and British History online. See February 15, 1693, for Phips's account. Other accounts, including Captain Short's, follow thereafter.
  82. ^ Sewall DI, Vol I. See June 8, 1693: "Mr. Danforth labors to bring Mr. Mather and Cooke together. Is great wrath about Mr. Cooke's being refused and tis supposed Mr. [Increase] Mather is the cause."
  83. ^ See Increase Mather's postscript to "Cases of Conscience", which was added around this time as a reprint in London and tagged to the end of his son's "Wonder's of the Invisible World".
  84. ^ Calef, Robert (1700)
  85. ^ Lounsberry (1941), p. 284
  86. ^ Paige (1877), 2: 627
  87. ^ Williamson (1832), pp. 260, 327
  88. ^ Williamson (1832), p. 637
  89. ^ Chadbourne, Ava H. (Apr 20, 1949). "Many Maine towns bear names of military men". Lewiston Evening Journal. pp. A-2. Retrieved 17 October 2015.

Bibliography

External links

Government offices
Preceded byas Governor of the Massachusetts Bay Colony Governor of the Province of Massachusetts Bay
May 16, 1692 – November 17, 1694
Succeeded by

Baca informasi lainnya yang berhubungan dengan : article

Article 19 Article 20

Read other articles:

Voce principale: Pallacanestro Varese. Pallacanestro VareseStagione 2017-2018Sport pallacanestro Squadra Pall. Varese Allenatore Attilio Caja Assistenti Massimo Bulleri Raimondo Diamante Matteo Jemoli Presidente Marco Vittorelli Direttore generale Claudio Coldebella Serie A6° (16-14) Play-offQuarti di finale Coppa Italianon qualificata Maggiori presenzeCampionato: Avramović, Cain, Okoye, Tambone (33)Totale: Avramović, Cain, Okoye, Tambone (33) Miglior marcatoreCampionato: Okoye (498)Tota…

American abolitionist (1805–1875)[ Ann Carroll Smith (née Fitzhugh; 1805–1875)[1] was an American abolitionist, mother of Elizabeth Smith Miller, and the spouse of Gerrit Smith. Her older brother was Henry Fitzhugh. Ann and Gerrit Smith's Peterboro, New York, home was a station on the Underground Railroad. Known as Nancy,[2] Ann Fitzhugh Smith frequently traveled via an enclosed carriage to permit her carriage to be used, in her absence, to convey veiled fugitives on their w…

Bosnië en Herzegovina op de Paralympische Spelen Land Bosnië en Herzegovina IOC-landcode BIH NPC Paralympisch Comité van Bosnië en Herzegovina Paralympische Zomerspelen 2020 in Tokio Aantal deelnemers 15 Aantal disciplines 4 MedaillesRang: 78 goud0 zilver0 brons1 totaal1 Bosnië en Herzegovina op de Zomerspelen 1992 · 1996 · 2000 · 2004 · 2008 · 2012 · 2016 · 2020 Bosnië en Herzegovina op de Winterspelen 1992-2006 · 2010 · 2014 · 2018 Andere gerelateerde deelnames  Joeg…

Glen Allen Plaats in de Verenigde Staten Vlag van Verenigde Staten Locatie van Glen Allen in Alabama Locatie van Alabama in de VS Situering County Fayette County en Marion County Type plaats Town Staat Alabama Coördinaten 33° 54′ NB, 87° 44′ WL Algemeen Oppervlakte 13,9 km² - land 13,9 km² - water 0,0 km² Inwoners (2006) 433 Hoogte 183 m Overig ZIP-code(s) 35559 FIPS-code 29944 Portaal    Verenigde Staten Glen Allen is een plaats (town) in de Amerikaanse staat Alabama…

American college basketball season 1952–53 Wisconsin Badgers men's basketballConferenceBig Ten ConferenceRecord13–9 (10–8 Big Ten)Head coachHarold E. FosterHome arenaUW FieldhouseSeasons← 1951–521953–54 → 1952–53 Big Ten Conference men's basketball standings vte Conf Overall Team W   L   PCT W   L   PCT No. 1 Indiana 17 – 1   .944 23 – 3   .885 No. 11 Illinois 14 – 4   .778 18 – 4   .818 M…

Frontera entre Gabón y Guinea Ecuatorial Mapa de Gabón que muestra la Frontera entre ese país y Guinea Ecuatorial.  Gabón  Guinea Ecuatorial Longitud total 350 kmParticularidades Disputa de varios islotes en la Bahía de CoriscoHistoriaCreación Convención franco-española de junio de 1900[editar datos en Wikidata] La Frontera entre Guinea Ecuatorial y Gabón se compone de un tramo fluvial, por la línea media del estuario del Muni desde la bahía de Corisco (Océano Atl…

Gertrud dari Süpplingenburg Gertrud dari Süpplingenburg (18 April 1115 – 18 April 1143) merupakan putri tunggal Kaisar Lothar III (Lothar dari Süpplingenburg), Adipati Sachsen, dan istrinya Richenza dari Northeim. Pada tanggal 29 Mei 1127, ia menikah dengan Heinrich yang Sombong, dari Welfen yang telah menjadi Adipati Bayern sejak tahun 1126. Setelah kematian ayah mertuanya, Heinrich juga menjadi Adipati Sachsen. Ia dan Gertrud merupakan orang tua Heinrich der Löwe, Adipati Sachsen dan Bay…

Field MarshalCountCurt von StedingkPortrait of Stedingk by Carl Wilhelm NordgrenBirth nameCurt Bogislaus Ludvig Christopher von StedingkBorn(1746-10-26)26 October 1746Swedish Pomerania, Holy Roman EmpireDied7 January 1837(1837-01-07) (aged 90)Stockholm, SwedenAllegiance Sweden Kingdom of France (1766–1783) United StatesService/branchSwedish ArmyFrench ArmyYears of service1766–1826RankField Marshal (Sweden)Colonel (France)UnitRégiment Royal-SuédoisBattles/warsAmerican War of Indep…

This article uses bare URLs, which are uninformative and vulnerable to link rot. Please consider converting them to full citations to ensure the article remains verifiable and maintains a consistent citation style. Several templates and tools are available to assist in formatting, such as reFill (documentation) and Citation bot (documentation). (August 2022) (Learn how and when to remove this template message) Oban LornFull nameOban Lorn Ladies Shinty ClubGaelic nameComann Camanachd Obain Lathar…

The following is a list of German indoor arenas. Indoor stadiums with a capacity of at least 2,000 are included. Images Stadium Capacity City State Home Team Opened Lanxess Arena 19,250[1] Cologne  North Rhine-Westphalia Kölner Haie 1998 Mercedes-Benz Arena Berlin 14,500 Berlin  Berlin Alba Berlin, Eisbären Berlin 2008 SAP Arena 14,500[1] Mannheim  Baden-Württemberg Rhein-Neckar Löwen, Adler Mannheim 2005 PSD Bank Dome 14,282[2] Düsseldorf  North …

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of the C…

1935 film by James Flood Wings in the DarkTheatrical release posterDirected byJames FloodScreenplay byJack KirklandFrank PartosDale Van Every (adaptation)E.H. Robinson (adaptation)Story byNell ShipmanPhilip D. Hurn (Original story)Based onthe story Eyes of the Eagleby Nell Shipman, Philip D. HurnProduced byArthur Hornblow, Jr.StarringMyrna LoyCary GrantCinematographyWilliam C. MellorEdited byWilliam SheaMusic byHeinz RoemheldDistributed byParamount PicturesRelease date February 1, 1935…

此條目需要补充更多来源。 (2019年1月26日)请协助補充多方面可靠来源以改善这篇条目,无法查证的内容可能會因為异议提出而被移除。致使用者:请搜索一下条目的标题(来源搜索:這個世界的角落 — 网页、新闻、书籍、学术、图像),以检查网络上是否存在该主题的更多可靠来源(判定指引)。 這個世界的角落 台版单行本封面 この世界の片隅に In This Corner of the World …

French footballer and manager (1954-2013) Bruno Metsu Metsu in 2012Personal informationFull name Bruno Jean Cornil Metsu[1]Date of birth (1954-01-28)28 January 1954[1]Place of birth Coudekerque-Branche,[1] FranceDate of death 15 October 2013(2013-10-15) (aged 59)[1]Place of death Coudekerque-Branche,[1] FranceHeight 1.79 m (5 ft 10 in)[2]Position(s) Midfielder[2]Youth career1969–1970 Hazebrouck1970–1973 AnderlechtSen…

Popa IslandNative name: Isla PopaBocas del Toro ArchipelagoGeographyCoordinates9°9′N 82°7′W / 9.150°N 82.117°W / 9.150; -82.117ArchipelagoBocas del Toro ArchipelagoArea53 km2 (20 sq mi)Highest elevation0 m (0 ft)AdministrationPanamaProvinceBocas del ToroDistrictBocas del Toro Popa Island (in Spanish: Isla Popa) is the second largest island in the Bocas del Toro Archipelago, Panama, with 53 square kilometres (20 square miles).[1 …

National demographics Parts of this article (those related to For example, the current administrative area for the Finnish languages consists of 66 municipalities, not just Eskilstuna and 5 municipalities in Norrbotten county) need to be updated. Please help update this article to reflect recent events or newly available information. (June 2019) Demographics of SwedenPopulation pyramid of Sweden in 2020Population 10,538,026 (Apr 2023)Growth rate0.5% (2022 est.)Birth rate10.83 births/1,000 popula…

Richard II, a 1947 radio production with George Ralph, Alec Guinness, Nicholas Hannen, Margaret Leighton, Ralph Richardson and Harry Andrews. Broadcast on the BBC Third Programme 11/5/1947[1] BBC Radio Drama is a London-based group within the BBC Radio operational business division of the BBC. BBC Radio Drama oversees the production and broadcast of radio dramas aired on the BBC Radio network. Radio dramas had been broadcast even before the public service company had an officially establ…

Dayton Outpatient Center StadiumDOC StadiumView of the main grandstandFormer namesWest Carrollton High School StadiumLocation5833 Student StreetWest Carrollton, Ohio, 45449Coordinates39°40′14″N 84°13′50″W / 39.6705099°N 84.2306667°W / 39.6705099; -84.2306667 (Dayton Outpatient Center Stadium)Capacity3,500Field size348 by 197 feet (106 m × 60 m)SurfaceArtificial TurfConstructionRenovated2017Construction cost$475,000Main contractorsThe Mo…

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Spandex fetishism – news · newspapers · books · scholar · JSTOR (May 2022) (Learn how and when to remove this template message) Booth babe wearing a spandex costume at the Electronic Entertainment Expo. Spandex fetishism is a fetishistic attraction to people weari…

Japanese Sanrio cartoon character Fictional character GudetamaGudetamaFirst appearance2013Created byAmy (Emi Nagashima (永嶋 瑛美, Nagashima Emi))[1][2]Voiced byShunsuke Takeuchi[3] (Netflix series)Roger Craig Smith (English dub of Netflix series)In-universe informationAliaslazy egg Gudetama (stylized in all lowercase; Japanese: ぐでたま) is a cartoon character created in 2013 by the Japanese company Sanrio,[4][5] a perpetually tired, apathetic ant…

Kembali kehalaman sebelumnya