Циклофилін B

Циклофилін B
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PPIB, CYP-S1, CYPB, HEL-S-39, OI9, SCYLP, peptidylprolyl isomerase B, B
Зовнішні ІД OMIM: 123841 MGI: 97750 HomoloGene: 726 GeneCards: PPIB
Пов'язані генетичні захворювання
osteogenesis imperfecta type 9[1]
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000942
NM_011149
RefSeq (білок)
NP_000933
NP_035279
Локус (UCSC) Хр. 15: 64.16 – 64.16 Mb Хр. 9: 65.97 – 65.97 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Циклофилін B (англ. Peptidylprolyl isomerase B) – білок, який кодується геном PPIB, розташованим у людей на короткому плечі 15-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 216 амінокислот, а молекулярна маса — 23 743[5].

Послідовність амінокислот
1020304050
MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDL
RIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDF
MIQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKDTNGS
QFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIA
DCGKIEVEKPFAIAKE

Цей білок за функціями належить до ізомераз, ротамаз. Локалізований у ендоплазматичному ретикулумі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Hasel K.W., Glass J.R., Godbout M., Sutcliffe J.G. (1991). An endoplasmic reticulum-specific cyclophilin. Mol. Cell. Biol. 11: 3484—3491. PMID 1710767 DOI:10.1128/MCB.11.7.3484
  • Arber S., Krause K.-H., Caroni P. (1992). S-cyclophilin is retained intracellularly via a unique COOH-terminal sequence and colocalizes with the calcium storage protein calreticulin. J. Cell Biol. 116: 113—125. PMID 1530944 DOI:10.1083/jcb.116.1.113
  • Mikol V., Kallen J., Walkinshaw M.D. (1994). X-ray structure of a cyclophilin B/cyclosporin complex: comparison with cyclophilin A and delineation of its calcineurin-binding domain. Proc. Natl. Acad. Sci. U.S.A. 91: 5183—5186. PMID 8197205 DOI:10.1073/pnas.91.11.5183

Примітки

Див. також

Read other articles:

Zeche Lothringen Allgemeine Informationen zum Bergwerk Maschinenhaus und Verwaltungsgebäude im Jahre 2005 Abbautechnik Untertagebau Informationen zum Bergwerksunternehmen Betreibende Gesellschaft Gewerkschaft Lothringen / Eschweiler Bergwerksverein Betriebsende 1967 Nachfolgenutzung Schacht 6 als Wetterschacht für Zeche Mont Cenis und Zeche Erin bis 1980 Geförderte Rohstoffe Abbau von Steinkohle Geographische Lage Koordinaten 51° 31′ 7″ N, 7° 16′ 57,6″...

 

كافرمعلومات عامةصنف فرعي من كافر جزء من كافر جانب من جوانب كافرreligious infidelity (en) النقيض مسلم تعديل - تعديل مصدري - تعديل ويكي بيانات جزء من سلسلة مقالات حولالإسلام العقيدة الإيمان توحيد الله الإيمان بالملائكة الإيمان بالكتب السماوية الإيمان بالرسل والأنبياء الإيمان باليوم ا...

 

Пісні Мертвого Півня Студійний альбомВиконавець Мертвий ПівеньДата випуску 2006Жанр рокЛейбл Атлантик РекордсХронологія Мертвий Півень Попередній Афродизіяки2003 Кримінальні сонети2008 Наступний Пісні Мертвого Півня — студійний альбом українського рок-гурту Мертвий пі...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أبريل 2019) كاترين لوتز معلومات شخصية الميلاد سنة 1966 (العمر 56–57 سنة)  مواطنة الولايات المتحدة  الحياة العملية المدرسة الأم جامعة هارفاردكلية سوارثمور  المهنة ع

 

Este artículo o sección necesita referencias que aparezcan en una publicación acreditada.Este aviso fue puesto el 1 de abril de 2021. Colette Besson Medallista olímpica Datos personalesNacimiento Saint-Georges-de-Didonne (Francia)7 de abril de 1946Nacionalidad(es) FrancesaFallecimiento Angoulins (Francia)9 de agosto de 2005Carrera deportivaDeporte Atletismo               Títulos Atletismo Mujeres Juegos Olímpicos Oro ...

 

Cross-legged sitting meditation pose Demonstrating lotus position Lotus position or Padmasana (Sanskrit: पद्मासन, romanized: padmāsana)[1] is a cross-legged sitting meditation pose from ancient India, in which each foot is placed on the opposite thigh. It is an ancient asana in yoga, predating hatha yoga, and is widely used for meditation in Hindu, Tantra, Jain, and Buddhist traditions. Variations include easy pose (Sukhasana), half lotus, bound lotus, and psychic ...

Namensgeber Ludwig Börne Der Vorsitzende der Ludwig-Börne-Stiftung Gotthelf bei seiner Begrüßungsrede zur Preisverleihung 2018 in der Frankfurter Paulskirche Der Ludwig-Börne-Preis ist eine Auszeichnung der Ludwig-Börne-Stiftung, mit Sitz in Frankfurt am Main, für hervorragende Leistungen deutschsprachiger Autoren in den Bereichen Reportage, Essay und Kritik. Inhaltsverzeichnis 1 Ziel und Verfahren 2 Stiftungsvorstand 3 Preisträger 4 Literatur 5 Weblinks 6 Einzelnachweise Ziel und Ver...

 

Building in Manhattan, New York United States Custom House (Manhattan) redirects here. For a general history of the former New York Custom House, see United States Custom House (New York City). United States historic placeAlexander Hamilton U.S. Custom HouseU.S. National Register of Historic PlacesU.S. National Historic LandmarkU.S. Historic districtContributing propertyNew York State Register of Historic PlacesNew York City Landmark No. 0020, 1022 The northern (left) and western (r...

 

This article may contain an excessive amount of intricate detail that may interest only a particular audience. Please help by spinning off or relocating any relevant information, and removing excessive detail that may be against Wikipedia's inclusion policy. (June 2016) (Learn how and when to remove this template message) Season of television series Vietnam's Next Top ModelSeason 3Country of originVietnamReleaseOriginal networkMultimedia JSC (domestically)VTV (domestically)CBS Television ...

General Council of Aran Conselh Generau d'AranTypeTypeUnicameral of Val d'AranHistoryFounded1991LeadershipSíndicMaria Vergés Pérez, UA-PSC since 29 October 2020 StructureSeats13Political groups  UA-PSC (9)  CDA (4)ElectionsLast election28 May 2023Meeting placeConselh Generau seat, Vielha e MijaranWebsiteconselharan.org The General Council of Aran (in Aranese Conselh Generau d'Aran) is the autonomous governing body of the region (unofficially considered a comarca) of...

 

Species of flowering plant Chrysosplenium glechomifolium Chrysosplenium glechomifolium flower Scientific classification Kingdom: Plantae Clade: Tracheophytes Clade: Angiosperms Clade: Eudicots Order: Saxifragales Family: Saxifragaceae Genus: Chrysosplenium Species: C. glechomifolium Binomial name Chrysosplenium glechomifoliumNutt. Chrysosplenium glechomifolium (also, C. glechomaefolium) is a species of flowering plant in the saxifrage family known as the Pacific golden saxifrage. This pl...

 

An editor has nominated this article for deletion.You are welcome to participate in the deletion discussion, which will decide whether or not to retain it.Feel free to improve the article, but do not remove this notice before the discussion is closed. For more information, see the guide to deletion.Find sources: Google Web Designer – news · newspapers · books · scholar · JSTOR%5B%5BWikipedia%3AArticles+for+deletion%2FGoogle+APIs%5D%5DAFD Freeware appli...

Pakistani politician Saeed Ahmed Khanسعید احمد خانMember of the National Assembly of PakistanIn office1 June 2013 – 31 May 2018ConstituencyNA-170 (Vehari-IV) Personal detailsBorn (1948-08-14) August 14, 1948 (age 75)NationalityPakistaniPolitical partyPakistan Muslim League (N) Saeed Ahmed Khan Manais (Urdu: سعید احمد خان منیس; born 14 August 1948) is a Pakistani politician who was a member of the National Assembly of Pakistan, from June 2013 to May 20...

 

Peta infrastruktur dan tata guna lahan di Komune Saint-Germain-lès-Arpajon.  = Kawasan perkotaan  = Lahan subur  = Padang rumput  = Lahan pertanaman campuran  = Hutan  = Vegetasi perdu  = Lahan basah  = Anak sungaiSaint-Germain-lès-ArpajonNegaraPrancisArondisemenPalaiseauKantonArpajonAntarkomuneCC de l'ArpajonnaisKode INSEE/pos91552 /  Saint-Germain-lès-Arpajon merupakan sebuah komune di kanton Arpajon di département Essonne. Merupakan pinggira...

 

A Russian state-owned international bank VTB CapitalHeadquarters at Federation TowerIndustryInvestment BankingFounded2008; 15 years ago (2008)HeadquartersMoscow, RussiaNumber of locationsMoscow, London, Singapore, Dubai, Hong Kong, Vienna, Sofia and KyivKey peopleAlexei YakovitskyServicesDebt, Equity, Global Commodities Markets, Developing Investment Management, and Advising Clients on M&A and ECMRevenue$671 million[1] (2017)Operating income-$831 m...

For the song by The Spinners, see The Rubberband Man. 2003 single by T.I.Rubber Band ManSingle by T.I.from the album Trap Muzik ReleasedDecember 30, 2003Recorded2003StudioPatchwerk Recordings, Atlanta, GAGenreSouthern hip hoptrapgangsta rapLength5:48 (album version)4:35 (clean version)3:58 (video version)LabelGrand HustleAtlanticSongwriter(s)Clifford HarrisLavell CrumpProducer(s)David BannerT.I. singles chronology Be Easy (2003) Rubber Band Man (2003) Let's Get Away (2004) Rubber Band Man is ...

 

American TV series or program GrendelDVD coverGenreActionDramaFantasyHorrorBased onBeowulf by AnonymousWritten byRon FernandezBerkeley AndersonDirected byNick LyonStarringChris BrunoBen CrossMarina SirtisMusic byNathan FurstCountry of originUnited StatesOriginal languageEnglishProductionProducersJeffery BeachPhillip J. RothCinematographyLorenzo SenatoreEditorMatt MichaelRunning time82 minutesProduction companyUniversal PicturesOriginal releaseNetworkSci Fi ChannelRelease January 13,...

 

This article is about the 2008 South Korean film. For the 1930s British magazine, see The Modern Boy. For Japanese fashion, see Modern girl. 2008 South Korean filmModern BoyTheatrical posterKorean nameHangul모던 보이Revised RomanizationModeon boiMcCune–ReischauerModŏn poi Directed byJung Ji-wooWritten byJung Ji-wooProduced byKang Woo-sukStarringPark Hae-ilKim Hye-sooCinematographyKim Tae-gyeongEdited byEom Yun-juWang Su-anMusic byLee Jae-jinDistributed byCJ EntertainmentRelease date Oc...

Actress and political activist, Militant Suffragette (1871–1944) Kitty MarionCriminal record pictureBornKatherina Maria Schafer12 March 1871Rietberg, German EmpireDied9 October 1944(1944-10-09) (aged 73)New York City, USNationalityGermanOccupation(s)actress, activistKnown forsuffrage, birth control advocacy, arson Kitty Marion 12 March 1871 – 9 October 1944) was born Katherina Maria Schäfer in Germany.[1] She emigrated to London in 1886 when she was fifteen, and she gre...

 

Academic journalModern Physics Letters ADisciplinePhysicsLanguageEnglishPublication detailsHistory1986-presentPublisherWorld Scientific (Singapore)Impact factor1.594 (2021)Standard abbreviationsISO 4 (alt) · Bluebook (alt1 · alt2)NLM (alt) · MathSciNet (alt )ISO 4Mod. Phys. Lett. AIndexingCODEN (alt · alt2) · JSTOR (alt) · LCCN (alt)MIAR · NLM (alt) · ScopusISSN0217-7323 (...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!