Share to: share facebook share twitter share wa share telegram print page

RGPD8

RGPD8
Ідентифікатори
Символи RGPD8, RANBP2L1, RGP8, RanBP2alpha, RANBP2-like and GRIP domain containing 8, RANBP2 like and GRIP domain containing 8
Зовнішні ІД OMIM: 602752 MGI: 894323 HomoloGene: 87808 GeneCards: RGPD8
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001164463
NM_011240
RefSeq (білок)
NP_001157935
NP_035370
Локус (UCSC) Хр. 2: 112.37 – 112.43 Mb Хр. 10: 58.28 – 58.33 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RGPD8 (англ. RANBP2-like and GRIP domain containing 8) – білок, який кодується однойменним геном, розташованим у людей на 2-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 1 765 амінокислот, а молекулярна маса — 198 993[4].

Послідовність амінокислот
1020304050
MRRSKADVERYVASVLGLTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYIC
TYINVQERDPKAHRFLGLLYELEENTEKAVECYRRSVELNPTQKDLVLKI
AELLCKNDVTDGRAKYWVERAAKLFPGSPAIYKLKEQLLDCEGEDGWNKL
FDLIQSELYVRPDDVHVNIRLVELYRSTKRLKDAVAHCHEAERNIALRSS
LEWNSCVVQTLKEYLESLQCLESDKSDWRATNTDLLLAYANLMLLTLSTR
DVQENRELLESFDSALQSAKSSLGGNDELSATFLEMKGHFYMYAGSLLLK
MGQHGNNVQWRALSELAALCYLIAFQVPRPKIKLREGKAGQNLLEMMACD
RLSQSGHMLLSLSRGKQDFLKEVVETFANKIGQSALYDALFSSQSPKDTS
FLGSDDIGKIDVQEPELEDLARYDVGAIRAHNGSLQHLTWLGLQWNSLPA
LPGIRKWLKQLFHRLPHETSRLETNAPESICILDLEVFLLGVVYTSHLQL
KEKCNSHHSSYQPLCLPFPVCKQLCTERQKSWWDAVCTLIHRKAVPGNLA
KLRLLVQHEINTLRAQEKHGLQPALLVHWAKYLQKTGSGLNSFYGQLEYI
GRSVHYWKKVLPLLKIIKKNSIPEPIDPLFKHFHSVDIQASEIVEYEEDA
HITFAILDAVNGNIEDAVTAFESIKSVVSYWNLALIFHRKAEDIENDALS
PEEQEECRNYLTKTRDYLIKIIDDGDSNLSVVKKLPVPLESVKQMLNSVM
QELEDYSEGGPLYKNGSLRNADSEIKHSTPSPTKYSLSPSKSYKYSPETP
PRWTEDRNSLLNMICQQVEAIKKEMQELKLNSSKSASRHRWPTENYGPDS
VPDGYQGSQTFHGAPLTVATTGPSVYYSQSPAYNSQYLLRPAANVTPTKG
SSNTEFKSTKEGFSIPVSADGFKFGISEPGNQEKKREKPLENDTGLQAQD
IRGRKKGRGVIFGQTSSTFTFADVAKSTSGEGFQFGKKDLNFKGFSGAGE
KLFSSRYGKMANKANTSGDFEKDDDAYKTEDSDDIHFEPVVQMPEKVELV
TGEEGEKVLYSQGVKLFRFDAEVRQWKERGLGNLKILKNEVNGKLRMLMR
REQVLKVCANHWITTTMNLKPLSGSDRAWMWSASDFSDGDAKLERLAAKF
KTPELAEEFKQKFEECQRLLLDIPLQTPHKLVDTGRAAKLIQRAEEMKSG
LKDFKTFLTNDQTKVTEEENKGSGTGVAGASDTTIKPNAENTGPTLEWDN
YDLREDALDDSVSSSSVHASPLASSPVRKNLFRFDESTTGSNFSFKSALS
LSKSPAKLNQSGTSVGTDEESVVTQEEERDGQYFEPVVPLPDLVEVSSGE
ENEQVVFSHRAEIYRYDKDVGQWKERGIGDIKILQNYDNKQVRIVMRRDQ
VLKLCANHRITPDMSLQNMKGTERVWVWTACDFADGERKVEHLAVRFKLQ
DVADSFKKIFDEAKTAQEKDSLITPHVSRSSTPRESPCGKIAVAVLEEIT
RERTDVIQGDDVADAASEVEVSSTSETTTKAVVSPPKFVFVSESVKRIFS
SEKSKPFAFGNSSATGSLFGFSFNAPLKSNNSETSSVAQSGSESKVEPKK
CELSKNSDIEQSSDSKVKNLSASFPTEESSINYTFKTPEKEPPLWHAEFT
KEELVQKLRSTTKSADHLNGLLREIEATNAVLMEQIKLLKSEIRRLERNQ
EREKSAANLEYLKNVLLQFIFLKPGSERERLLPVINTMLQLSPEEKGKLA
AVAQDEEENPSRSSG

Кодований геном білок за функцією належить до фосфопротеїнів.

Література

  • Van Valkenburgh H., Shern J.F., Sharer J.D., Zhu X., Kahn R.A. (2001). ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins. J. Biol. Chem. 276: 22826—22837. PMID 11303027 DOI:10.1074/jbc.M102359200

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:9849 (англ.) . Процитовано 18 вересня 2017.
  4. UniProt, O14715 (англ.) . Архів оригіналу за 7 серпня 2017. Процитовано 18 вересня 2017.

Див. також

Read more information:

ISutradara Anggy Umbara Produser Agung Haryanto Ditulis oleh Anggy Umbara SkenarioAnggy UmbaraCeritaAnggy UmbaraPemeranAmanda RigbyOmar DanielOnadio LeonardoAnggika BölsterliSinematograferAwankjjPenyuntingGita MiajiAnggy UmbaraPerusahaanproduksiKlikFilm ProductionsUmbara Brothers FilmCanary StudiosDistributorKlikFilmTanggal rilis 16 Juli 2021 (2021-07-16) (Indonesia) Negara Indonesia Bahasa Indonesia I (pengucapan bahasa Inggris: [ai]; bahasa Indonesia: Saya) adalah film drama…

Bristol—  Chính quyền đơn nhất & Thành phố  — Theo chiều kim đồng hồ từ trên xuống: Đường chân trời Bristol, Tòa nhà tưởng niệm Wills, cầu dây võng Clifton và Tháp Cabot BristolTọa độ: 51°27′14″B 2°35′48″T / 51,45389°B 2,59667°T / 51.45389; -2.59667 Quốc gia có chủ quyền Vương quốc AnhQuốc gia cấu thành AnhVùngTây Nam AnhCeremonial countyHistoric…

Pop!_OS Parte de Linux (Unix-like) Información generalTipo de programa distribución LinuxDesarrollador System76Lanzamiento inicial 27 de octubre de 2017[1]​Información técnicaPlataformas admitidas x86-64Interfaz gráfica predeterminada GNOMEVersionesÚltima versión estable 22.04 LTS (info) ( 25 de abril de 2022 (1 año, 7 meses y 8 días))Enlaces Sitio web oficial Repositorio de código [editar datos en Wikidata] Pop!_OS es una distribución de Linux gratuita …

شاليمار   الإحداثيات 30°26′40″N 86°34′55″W / 30.444444444444°N 86.581944444444°W / 30.444444444444; -86.581944444444  تاريخ التأسيس 1947  تقسيم إداري  البلد الولايات المتحدة[1][2]  التقسيم الأعلى مقاطعة أكلووسا، فلوريدا  خصائص جغرافية  المساحة 0.74416 كيلومتر مربع0.738145 كيلومتر م…

Fragmentation of Poland between the sons of Bolesław III in 1138:   Seniorate Province of Władysław II.   Silesian Province of Władysław II.   Masovian Province of Bolesław IV.   Greater Poland Province of Mieszko III.   Sandomierz Province of Henry.   Łęczyca Province of Salomea of Berg.   Pomeranian vassals under the rule of Władysław II. The last will and testament of the Piast duke Bolesław III Wrymouth of Polan…

قصر نصراط تقسيم إداري البلد المغرب  الجهة درعة تافيلالت الإقليم زاكورة الدائرة زاكورة الجماعة القروية تاكونيت المشيخة نصراط السكان التعداد السكاني 148 نسمة (إحصاء 2004)   • عدد الأسر 17 معلومات أخرى التوقيت ت ع م±00:00 (توقيت قياسي)[1]،  وت ع م+01:00 (توقيت صيفي)[1]  تعد…

1975 studio album by Willie Colón The Good, the Bad, the UglyStudio album by Willie Colón and Yomo ToroReleased1975 (1975)RecordedNew York CityGenreSalsaLabelFania RecordsProducerWillie ColónWillie Colón and Yomo Toro chronology Se Chavó el Vecindario!(1975) The Good, the Bad, the Ugly(1975) Metiendo Mano(1977) The Good, the Bad, the Ugly is the ninth studio album by Willie Colón with backing from Yomo Toro on cuatro and vocal contributions from his regular singer Héctor Lavoe an…

Marco Davide Faraoni Informasi pribadiTanggal lahir 25 Oktober 1991 (umur 32)Tempat lahir Bracciano, ItaliaTinggi 1,80 m (5 ft 11 in)[1]Posisi bermain BekInformasi klubKlub saat ini UdineseNomor 6Karier junior2004–2010 Lazio2010–2011 InternazionaleKarier senior*Tahun Tim Tampil (Gol)2011–2012 Internazionale 14 (1)2012– Udinese 1 (0)Tim nasional‡2006–2007 Italia U-16 5 (0)2007–2008 Italia U-17 11 (0)2009 Italia U-18 5 (0)2008–2010 Italia U-19 6 (0)2011 …

SMA Negeri 2 BrebesInformasiDidirikan18 Desember 1973 (Sebagai Sekolah Menengah Pembangunan Persiapan (SMPP)) 19 Agustus 1985 (berubah menjadi Sekolah Menengah Umum Tingkat Atas (SMA) Negeri 2 Brebes)JenisNegeriAkreditasiANomor Pokok Sekolah Nasional20326436Kepala SekolahDani Rumdani, S.Pd., M.Pd.Jumlah kelas36Jurusan atau peminatanMIPA dan IPSRentang kelasX MIPA, X IPS, XI MIPA, XI IPS, XII MIPA, XII IPSKurikulumKurikulum 2013AlamatLokasi, Jawa Tengah, IndonesiaSitus websman2-bre…

List of state assembly constituencies in India Main article: Manipur Legislative Assembly Manipur Legislative AssemblyLegislative Assembly of ManipurTypeTypeUnicameral Term limits5 yearsSeats60ElectionsVoting systemFirst past the postLast election28 feb- 5 March 2022Next election2027Meeting placeManipur Legislative Assembly, Capital Complex, Thangmeiband, Imphal, Manipur, India-795001Websitehttps://manipurassembly.net/ Assembly constituencies of Manipur The Manipur Legislative Assembly is the un…

جزء من سلسلة مقالات حولبوابة المجتمع إرشادات الركائز الخمس إمكان التحقق ويكيبيديا ليست وجهة النظر المحايدة حقوق التأليف والنشر لا أبحاث غير منشورة السير الذاتية قواعد النقاش افترض حسن النية تصويت مساعدة مبتدئون تحرير الصفحات بداية مقالة تسمية المقالات روابط تصنيف تسمية ا…

American politician (1924–2007) For other people named Henry Hyde, see Henry Hyde (disambiguation). Henry HydeMember of the U.S. House of Representativesfrom Illinois's 6th districtIn officeJanuary 3, 1975 – January 3, 2007Preceded byHarold R. CollierSucceeded byPeter RoskamChair of the House Foreign Affairs CommitteeIn officeJanuary 3, 2001 – January 3, 2007Preceded byBenjamin GilmanSucceeded byTom LantosChair of the House Judiciary CommitteeIn officeJanuary …

International award for parks and green spaces For the unrelated roadside assistance company, see Green Flag. Green Flag AwardRecognition of well managed open spaces.Standards organizationKeep Britain TidyOn behalf of MHCLG.Effective regionWorldwide; primarily United Kingdom.Effective since1996; 27 years ago (1996)Product categoryParks, publicly accessible spaces.Type of standardIndustryWebsitewww.greenflagaward.org The Green Flag Award is an international accreditation given t…

Stasiun Ngawen Ngawen LokasiNgawen, Ngawen, Blora, Jawa TengahIndonesiaOperatorKereta Api IndonesiaDaerah Operasi IV SemarangLetak dari pangkalkm 88+961 lintas Demak–Purwodadi–Wirosari–Blora[1]Informasi lainKode stasiunNA3727[2]KlasifikasiIII/kecil[2]SejarahDibuka1894Ditutup1996Operasi layanan - Lokasi pada petaSunting kotak info • L • BBantuan penggunaan templat ini Stasiun Ngawen (NA) adalah stasiun kereta api nonaktif yang terletak di Ngawen, Ngawen…

British Thoroughbred racehorse PyledriverRacing silks of Knox & Wells LtdSireHarbour WatchGrandsireAcclamationDamLa PyleDamsireLe HavreSexColtFoaled14 March 2017[1]CountryUnited KingdomColourBayBreederKnox & Wells Limited & Roger DevlinOwnerKnox & Wells Ltd & Roger DevlinLa Pyle PartnershipTrainerWilliam Muir & Chris GrassickRecord19 8-4-1Earnings£1,848,185Major winsAscendant Stakes (2019)King Edward VII Stakes (2020)Great Voltigeur Stakes (2020)Coronation Cup (2…

Oddział II Sztabu Generalnego Historia Państwo  Polska Sformowanie 1945 Rozformowanie 1951 Tradycje Kontynuacja Zarząd II Sztabu Generalnego Organizacja Numer JW 2142[a] Oddział II Sztabu Generalnego Wojska Polskiego – organ wywiadu wojskowego działający w ramach struktur Sztabu Generalnego Wojska Polskiego ludowego Wojska Polskiego, istniejący w Polsce od 1945 do 1951 roku. Następnie przemianowany na Zarząd II Sztabu Generalnego Wojska Polskiego. Także od 17 lipca 1947 roku do …

American television personality, producer, and former model Tyra BanksBanks in 2020BornTyra Lynne Banks (1973-12-04) December 4, 1973 (age 50)Inglewood, California, U.S.Other namesBanXAlma materImmaculate Heart High SchoolOccupations Model television personality producer writer actress businesswoman Years active1991–presentTelevision America's Next Top Model The Tyra Banks Show America's Got Talent FABLife Dancing with the Stars Height5 ft 10 in (1.78 m)[…

Acts of sexual violence committed by combatants during armed conflict, war or military occupation Monument to the Condottiero Giovanni dalle Bande Nere depicting a man kidnapping a woman (Piazza San Lorenzo, Florence) Part of a series onWar History Prehistoric Ancient Post-classical Early modern napoleonic Late modern industrial fourth-gen Military Organization Command and control Defense ministry Army Navy Air force Marines Coast guard Space force Reserves Regular / Irregular Ranks Specialties:…

Canadian historian (born 1944) Zenon KohutBornZenon Kohut (1944-01-18) 18 January 1944 (age 79)Yaniv (Ivano-Frankove), UkraineNationalityAmerican-CanadianAlma materUniversity of PennsylvaniaOccupation(s)Historian; Professor EmeritusKnown forHistory of Ukraine Zenon Eugene Kohut (Ukrainian: Зенон-Євген Когут; born 18 January 1944) is a Canadian historian specializing in early modern Ukrainian history. He retired as professor emeritus, University of Alberta. From 1992…

Spicy rice dish with shrimp This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Shrimp creole – news · newspapers · books · scholar · JSTOR (February 2013) (Learn how and when to remove this template message) Shrimp creoleShrimp creoleCourseMainPlace of originUnited StatesRegion or stateLouisianaMain ingredientsShr…

Russian commercial bank, headquartered in Kazan, Tatarstan, Russia Ak Bars BankRussian: Ак Барс БанкAk Bars Bank headquartersTypebankIndustrybankingFounded1993; 30 years ago (1993)FateactiveHeadquartersKazan, RussiaRevenue34,032,400,000 Russian ruble (2017) OwnerGovernment of Tatarstan, Svyazinvestneftekhim, etc.Number of employees6300 (2022)Websiteakbars.ru PJSC Ak Bars Bank (Russian: Ак Барс Банк) is one of the leading Russian regional universal …

Russian writer and journalist (1894–1940) In this name that follows Eastern Slavic naming conventions, the patronymic is Emmanuilovich and the family name is Babel. Isaac BabelBorn13 July [O.S. 1 July] 1894Odesa, Russian Empire(present-day Ukraine)Died27 January 1940(1940-01-27) (aged 45)Butyrka prison, Moscow, Russian SFSR, USSROccupationjournalist, short story writer and playwrightCitizenshipRussian EmpireUSSRNotable worksRed Cavalry Odessa StoriesSignature Isaac E…

British thriller television series The Devil's HourGenre Thriller Drama Supernatural Created byTom MoranWritten byTom MoranStarring Jessica Raine Peter Capaldi Nikesh Patel Music byThe Newton BrothersCountry of originUnited KingdomOriginal languageEnglishNo. of series1No. of episodes6ProductionExecutive producers Sue Vertue Steven Moffat Tom Moran Production locations London Farnborough Film Studios Wokingham Cinematography Stuart Biddlecombe Bjørn Ståle Bratberg Editors Joe Randall-Cutler Mar…

Northern Irish footballer Ryan McGivern McGivern playing for Leicester City in 2010Personal informationFull name Ryan McGivern[1]Date of birth (1990-01-08) 8 January 1990 (age 33)[2]Place of birth Newry, Northern Ireland[2]Height 5 ft 10 in (1.78 m)[2]Position(s) DefenderTeam informationCurrent team Newry CityYouth career2006–2008 Manchester CitySenior career*Years Team Apps (Gls)2008–2013 Manchester City 1 (0)2008 → Morecambe (loan) 5 (1…

Indian politician Nalini Ranjan Ghosh (Bengali: নলিনী রঞ্জন ঘোষ) was an Indian politician. In the 1958 by-election, he was elected to the Lok Sabha from the Cooch Behar constituency.[1] In 1962, he was elected to the Lok Sabha from the Jalpaiguri constituency.[2] Ghosh was a member of the Indian National Congress party.[2] References ^ Bengal Congress MP, MLA. West Bengal Pradesh Congress Committee. Archived from the original on 10 January 2011. …

American knife manufacturer Kershaw Knives/Kai USA Ltd.TypeCorporationIndustryManufacturingFoundedPortland, Oregon1974; 49 years ago (1974)HeadquartersTualatin, OregonKey peopleJack Igarashi, Chief of North American Operations, Kai USA ltd., Pete Kershaw, FounderProductsKnivesNumber of employees430Websitehttp://www.kaiusaltd.com Kershaw Knives designs, sources and manufactures a wide range of knives, including pocketknives, sporting knives, and kitchen cutlery. Kershaw is a bra…

American boxer Jake LaMottaLaMotta in a postcard dated 1952BornGiacobbe LaMotta(1922-07-10)July 10, 1922New York City, U.S.DiedSeptember 19, 2017(2017-09-19) (aged 95)Aventura, Florida, U.S.Other namesThe Bronx BullThe Raging BullStatisticsWeight(s)MiddleweightLight heavyweightHeight5 ft 8 in (173 cm)[1]Reach67 in (170 cm)[1]StanceOrthodox Boxing recordTotal fights106[2]Wins83Wins by KO30Losses19Draws4 Giacobbe Jake LaMotta (July 10, 192…

HulvákyDomy v HulvákáchLokalitaCharakterčtvrťMěstský obvodMariánské Hory a HulvákyObecOstravaOkresOstrava-městoKrajMoravskoslezský krajHistorická zeměMoravaStátČesko ČeskoZeměpisné souřadnice49°49′ s. š., 18°14′0″ v. d.Základní informacePočet obyvatel914 (2021)[1]Katastrální územíZábřeh-Hulváky (1,7529 km²)PSČ709 00Počet domů174 (2011)[2] Hulváky Další údajeKód části obce414115Kód k. ú.713970Geodata (OSM)OSM, WMF multi…

Air terjun MadakaripuraAir terjun MadakaripuraLokasiDesa Sapih, Kecamatan Lumbang, Kabupaten Probolinggo, Provinsi Jawa TimurKoordinat7°51′20.3″S 113°00′26.0″E / 7.855639°S 113.007222°E / -7.855639; 113.007222Koordinat: 7°51′20.3″S 113°00′26.0″E / 7.855639°S 113.007222°E / -7.855639; 113.007222TipeHorsetailTinggi total200 meter (656 ft)Jumlah titik1 (Satu)Anak sungaiSungai Lawean Air terjun Madakaripura adalah sebuah ai…

Kembali kehalaman sebelumnya