CPEB3

CPEB3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CPEB3, cytoplasmic polyadenylation element binding protein 3
Зовнішні ІД OMIM: 610606 MGI: 2443075 HomoloGene: 40992 GeneCards: CPEB3
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001178137
NM_014912
NM_001290826
NM_001290827
NM_001290828
NM_001290829
NM_198300
RefSeq (білок)
NP_001171608
NP_055727
NP_001277755
NP_001277756
NP_001277757
NP_001277758
NP_938042
Локус (UCSC) Хр. 10: 92.05 – 92.29 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CPEB3 (англ. Cytoplasmic polyadenylation element binding protein 3) – білок, який кодується однойменним геном, розташованим у людей на 10-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 698 амінокислот, а молекулярна маса — 76 014[4].

Послідовність амінокислот
1020304050
MQDDLLMDKSKTQPQPQQQQRQQQQPQPESSVSEAPSTPLSSETPKPEEN
SAVPALSPAAAPPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPQEPAAPG
ASLSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGT
FSPQIGLAQTQHHQQPPPPAPAPQPAQPAQPPQAQPPQQRRSPASPSQAP
YAQRSAAAAYGHQPIMTSKPSSSSAVAAAAAAAAASSASSSWNTHQSVNA
AWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSNV
IAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLE
NSLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGT
DNIMALNNAFLDDSHGDQALSSGLSSPTRCQNGERVERYSRKVFVGGLPP
DIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQAL
IDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKT
IFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSN
QQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAP
FFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як регуляція трансляції, альтернативний сплайсинг, метилювання. Білок має сайт для зв'язування з РНК. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані, клітинних контактах, клітинних відростках, синапсах.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Salehi-Ashtiani K., Luptak A., Litovchick A., Szostak J.W. (2006). A genomewide search for ribozymes reveals an HDV-like sequence in the human CPEB3 gene. Science. 313: 1788—1792. PMID 16990549 DOI:10.1126/science.1129308
  • Peng S.C., Lai Y.T., Huang H.Y., Huang H.D., Huang Y.S. (2010). A novel role of CPEB3 in regulating EGFR gene transcription via association with Stat5b in neurons. Nucleic Acids Res. 38: 7446—7457. PMID 20639532 DOI:10.1093/nar/gkq634
  • Chen Y.C., Sargsyan K., Wright J.D., Huang Y.S., Lim C. (2014). Identifying RNA-binding residues based on evolutionary conserved structural and energetic features. Nucleic Acids Res. 42: E15—E15. PMID 24343026 DOI:10.1093/nar/gkt1299
  • Giangarra V., Igea A., Castellazzi C.L., Bava F.A., Mendez R. (2015). Global analysis of CPEBs reveals sequential and non-redundant functions in mitotic cell cycle. PLoS ONE. 10: E0138794—E0138794. PMID 26398195 DOI:10.1371/journal.pone.0138794

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:21746 (англ.) . Процитовано 19 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, Q8NE35 (англ.) . Архів оригіналу за 2 серпня 2016. Процитовано 19 вересня 2017.

Див. також

Read other articles:

BikeMiOverviewLocaleMilan, ItalyTransit typeBicycle sharing systemNumber of stations325[1]Daily ridership15,890 (2013 average)[2]OperationBegan operation3 December 2008Operator(s)Clear ChannelATMNumber of vehicles5,430[1] BikeMi station and bikes near Diaz square. BikeMi is a public bicycle sharing system in Milan, Italy. It was launched on 8 December 2008 and is contracted to and operated by Clear Channel on the basis of its SmartBike system.[3] The scheme enc...

 

 

Artikel ini membutuhkan rujukan tambahan agar kualitasnya dapat dipastikan. Mohon bantu kami mengembangkan artikel ini dengan cara menambahkan rujukan ke sumber tepercaya. Pernyataan tak bersumber bisa saja dipertentangkan dan dihapus.Cari sumber: Cursed seri TV 2020 – berita · surat kabar · buku · cendekiawan · JSTOR CursedGenre Fantasy Serial drama Adventure Action Pembuat Frank Miller Tom Wheeler BerdasarkanCursedoleh Frank MillerTom WheelerPem...

 

 

Pour les articles homonymes, voir Crusader. Opération Crusader Carte du théâtre d'opération de l'opération Crusader. Informations générales Date 16 novembre 1941 - 17 décembre 1941 Lieu Frontière lybio-égyptienne Issue Victoire alliée Belligérants  Reich allemand Royaume d'Italie Royaume-Uni Raj britannique Armée polonaise de l'ouest Australie Nouvelle-Zélande Commandants Erwin Rommel Ludwig Crüwell Claude Auchinleck Alan Gordon Cunningham Charles Norrie Neil Ritchie Force...

El modelo de Pickman de H. P. Lovecraft Primera página del manuscrito original mecanografiado.Género Cuento Subgénero Terror Ambientada en Boston Idioma Inglés Título original Pickman's Model Texto original Weird Tales/Volume 10/Issue 4/Pickman's Model en WikisourcePublicado en Weird Tales y The Outsider País Estados Unidos Fecha de publicación Octubre de 1927 [editar datos en Wikidata] El modelo de Pickman (Pickman's Model en inglés) es un relato corto escrito en 1926 ...

 

 

Bailamos Greatest Hits Álbum de grandes êxitos de Enrique Iglesias Lançamento 1 de Junho de 1999 Gravação 1995 - 1999 Gênero(s) Pop Duração 39 min 09 seg Formato(s) CD, Cassete Gravadora(s) Fonovisa Records Cronologia de Enrique Iglesias Cosas del Amor(1998) Enrique(1999) Bailamos Greatest Hits é um álbum dos melhores êxitos do cantor Enrique Iglesias, lançado a 1 de Junho de 1999. Críticas profissionais Avaliações da crítica Fonte Avaliação Allmusic (sem nota) [1] Esta ...

 

 

Lion IslandView of Lion Island from Iron Ladder BeachGeographyLocationBroken BayAdministrationAustraliaStateNew South Wales Protected area in New South Wales, AustraliaLion Island Nature ReserveNew South WalesIUCN category Ia (strict nature reserve) Sunset view of Lion IslandLion Island Nature ReserveNearest town or cityGosfordCoordinates33°33′25″S 151°19′04″E / 33.55694°S 151.31778°E / -33.55694; 151.31778Established1956Area0.08 km2 (0.0 sq ...

У Вікіпедії є статті про інші значення цього терміна: Труш. Володимир Васильович Труш  Капітан Загальна інформаціяНародження 10 вересня 1977(1977-09-10)Новий Розділ, Львівська областьСмерть 31 жовтня 2015(2015-10-31) (38 років)м. Авдіївка, Донецька областьПоховання Личаківський цвин

 

 

مجرة الدوامة أو مسييه 51 مجرة الدوامة صورة مجرة الدوامة، حيث يظهر على اليسار الصورة الأصلية، بالضوء المرئي، وإلى اليمين صورة الأشعة تحت الحمراء. مراقبة البيانات (J2000 حقبة) جزء من مجموعة M51  الكوكبة السلوقيان رمز الفهرس M51 (فهرس مسييه)7C 132753.10+473032.00 (Seventh Cambridge Survey)7C 132746.79+472722.00 (...

 

 

Incident during the 2022 Russian invasion of Ukraine April 2022 Kharkiv cluster bombingPart of the bombing of Kharkiv in the Battle of Kharkiv during the Russian invasion of UkraineKharkiv buildings after the bombingLocationKharkiv, UkraineDate15 April 2022Attack typecluster munition bombingDeaths9[1]Injured35[1]Perpetrators Russian Armed Forces vteRussian invasion of UkraineNorthern Ukraine campaign Antonov Airport Chernobyl Hostomel Ivankiv Kyiv airstrikes shopping cent...

This article is about Hardware Architecture; the term refers to the architectural design of a physical device, or system, often comprising both hardware and software. For other uses, see for example Computer architecture, Computer hardware or Architecture (disambiguation). An orthographically projected diagram of the F-117A Nighthawk. An F-117 conducts a live exercise bombing run using GBU-27 laser-guided bombs. In engineering, hardware architecture refers to the identification of a system's ...

 

 

College sports rivalry Indiana–Kentucky rivalry Indiana Hoosiers Kentucky Wildcats SportFootball, basketball, baseball [Interactive fullscreen map + nearby articles] Locations of Indiana and Kentucky The Indiana–Kentucky rivalry is a college sports rivalry between the Indiana University Bloomington Hoosiers and the University of Kentucky Wildcats. The rivalry between these two schools, located about 180 miles (290 km) apart, dates to their first college football game in 1893, and has...

 

 

This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: Insignia Films – news · newspapers · books · scholar · JSTOR (March 2012) The topic of this artic...

Seek: Reports from the Edges of America & Beyond First editionAuthorDenis JohnsonCountryUnited StatesLanguageEnglishPublisherHarperCollinsPublication dateApril 24, 2001Media typePrintPages238ISBN0-06-018736-0 Seek: Reports from the Edges of America & Beyond is a 2001 collection of essays by Denis Johnson. The book chronicles the author's travels through Africa, Afghanistan, and America. Spanning two decades, his essays are generally sympathetic towards the obscure groups of peopl...

 

 

1988 single by The Blue HeartsBlue Hearts ThemeSingle by The Blue Heartsfrom the album Young and Pretty[1] A-sideBlue Hearts ThemeChernobylB-side'Sha La La'ReleasedJuly 1, 1988April 25, 2002 (rerelease)RecordedOnkio HausGenrePunk rockLength9m17sLabelindependentSongwriter(s)Hiroto KōmotoProducer(s)The Blue HeartsThe Blue Hearts singles chronology 'Kiss Shite Hoshii' (1987) Blue Hearts Theme (1988) 'Train-Train' (1988) Blue Hearts Theme (ブルーハーツのテーマ, Burū Hātsu no ...

 

 

Spanish TV series or program HermanosPromotional posterGenreDramaDirected bySalvador CalvoJoaquín LlamasStarringMaría ValverdeAntonio VelázquezÁlvaro CervantesCountry of originSpainOriginal languageSpanishNo. of seasons1No. of episodes6ProductionProduction companiesMediaset EspañaMultipark FicciónOriginal releaseNetworkTelecincoRelease16 September (2014-09-16) –21 October 2014 (2014-10-21) Hermanos is a Spanish drama television series. Produced by Mediaset España ...

Опис файлу Опис Дворнік Іван Федорович. міський голова Броварів Джерело з книги Бровари - мій дім Час створення 1950-ті Автор зображення невідомо Ліцензія Ця робота є невільною — тобто, не відповідає визначенню вільних творів культури. Згідно з рішенням фонду «Вікімеді...

 

 

Dam in YeldariYeldari DamLocation of Yeldari Dam in IndiaOfficial nameYeldari Dam D03211LocationYeldariCoordinates19°43′11″N 76°43′55″E / 19.7196664°N 76.7319488°E / 19.7196664; 76.7319488Opening date1968[1]Owner(s)Government of Maharashtra, IndiaDam and spillwaysType of damEarthfillImpoundsPurna riverHeight51.2 m (168 ft)Length4,232 m (13,885 ft)ReservoirCreatesYeldariTotal capacity0.934 km3 (0.224 ...

 

 

This article has no lead section. Please improve this article by adding one in your own words. (December 2022) (Learn how and when to remove this template message) Psychoactive substances Psychoactive substances derived from genetically modified organisms. Cocaine GMO plant: Nicotiana benthamiana (a tobacco plant)[1] Psilocybin GMO bacteria: Escherichia coli[2] GMO yeast: Baker’s yeast[3][4][5] THC GMO bacteria: Zymomonas mobilis (used to produce tequ...

Multiplex cinema hall in Mumbai, India Sterling CineplexSterling Cinema, Sterling TheatreAddress65, Cinema Lane, Marzaban Road, FortMumbaiIndiaCoordinates18°56′17″N 72°49′59″E / 18.938°N 72.833°E / 18.938; 72.833TypeMultiplexConstructionOpened1969Reopened2007Years active1969–presentWebsitehttp://www.sterlingcineplex.in/ Sterling Cineplex (previously known as Sterling Cinema) is a multiplex cinema hall in Mumbai. Opened (as a multiplex) in 2007, Sterling h...

 

 

American women's rights leader, suffragist, social reformer and writer Josephine Henry in 1898 Josephine Kirby Henry (February 22, 1846 – January 8, 1928) was an American Progressive Era women's rights leader, suffragist, social reformer, and writer from Versailles, Kentucky in the United States. Henry was a strong advocate for women and was a leading proponent of legislation that would grant married women property rights. Henry lobbied hard for the adoption of the Kentucky 1894 Married Wom...

 

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!