Кальнексин

Кальнексин
Ідентифікатори
Символи CANX, CNX, IP90, P90, calnexin
Зовнішні ІД OMIM: 114217 MGI: 88261 HomoloGene: 1324 GeneCards: CANX
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001024649
NM_001746
NM_001110499
NM_001110500
NM_007597
RefSeq (білок)
NP_001103969
NP_001103970
NP_031623
Локус (UCSC) Хр. 5: 179.68 – 179.73 Mb Хр. 11: 50.18 – 50.22 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Кальнексин (англ. Calnexin) – білок, який кодується геном CANX, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 592 амінокислот, а молекулярна маса — 67 568[4].

Послідовність амінокислот
1020304050
MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTT
APPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKY
DGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQY
EVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKL
HFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEI
LVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
PDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW
EAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPR
KIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDW
ANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILTVALPVFLVIL
FCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEE
KQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE

Цей білок за функцією належить до шаперонів. Білок має сайт для зв'язування з іонами металів, іоном кальцію, лектинами. Локалізований у мембрані, ендоплазматичному ретикулумі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Gong Q., Jones M.A., Zhou Z. (2006). Mechanisms of pharmacological rescue of trafficking-defective hERG mutant channels in human long QT syndrome. J. Biol. Chem. 281: 4069—4074. PMID 16361248 DOI:10.1074/jbc.M511765200
  • David V., Hochstenbach F., Rajagopalan S., Brenner M.B. (1993). Interaction with newly synthesized and retained proteins in the endoplasmic reticulum suggests a chaperone function for human integral membrane protein IP90 (calnexin). J. Biol. Chem. 268: 9585—9592. PMID 8486646

Примітки

  1. Human PubMed Reference:.
  2. Mouse PubMed Reference:.
  3. HUGO Gene Nomenclature Commitee, HGNC:1473 (англ.) . Процитовано 30 січня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  4. UniProt, P27824 (англ.) . Архів оригіналу за 6 січня 2017. Процитовано 30 січня 2017.

Див. також

Read other articles:

Artikel ini bukan mengenai Milenarianisme. Halaman ini berisi artikel tentang suatu konsep Kristen. Untuk artikel tentang Generasi Milenial, lihat Milenial. Bagian dari seriEskatologi AntaragamaAkhir zaman Apokaliptisisme Fenomena 2012MilenarianismeArmageddonPengadilan TerakhirKebangkitan orang matiYa'juj dan Ma'jujEskatologi Lia Eden Eskatologi HinduEskatologi Hindu Eskatologi IslamTempat 'Arasy Âkhirah Barzakh Firdaws `Adn Jannah Jahannam Jahim Kaʿbah Mahsyar Shirāth Pohon Neraka Tokoh U...

 

Puente internacional del Bajo Guadiana Localización geográficaCruza Río ChanzaCoordenadas 37°33′20″N 7°31′21″O / 37.555555555556, -7.5225Localización administrativaPaís España España PortugalLocalidad El Granado (Andalucía) - Pomarão (Alentejo)CaracterísticasTipo puente sobre pilaresMaterial Hormigón armadoLargo 150Ancho 11Gálibo de tráfico (no navegable)Nº de vanos 1Nº de pilares 2Peaje NoHistoriaConstrucción 2008-2009In...

 

نيكولا بوخارين (بالروسية: Николай Иванович Бухарин)‏  الأمين العام للجنة التنفيذية للكومنترن في المنصبOctober 1926 – April 1929 غريغوري زينوفيف لا أحد معلومات شخصية اسم الولادة نيكولا ايفانوفيتش بوخارين الميلاد 9 أكتوبر 1888(1888-10-09)موسكو، الامبراطورية الروسية الوفاة 15 مارس 1938 (49 س...

Facility in Watsonville, United States Elkhorn Slough Marsh Birds The Elkhorn Slough National Estuarine Research Reserve is a nature reserve that is located at 1700 Elkhorn Road in Watsonville, California.[1] The reserve encompasses the central shore of Monterey Bay and is approximately 100 miles (160 km) south of San Francisco, California.[2] The Elkhorn Slough is established as a part of the National Oceanic and Atmospheric Administration and is being managed as the Elk...

 

2020 single by Lukas Graham featuring G-EazyShare That LoveSingle by Lukas Graham featuring G-Eazyfrom the album 4 (The Pink Album) Released21 August 2020Length2:52LabelWarner RecordsSongwriter(s) Dave Gibson Digital Farm Animals Gerald Earl Gillum Lukas Forchhammer Morten Ristorp Neil Ormandy Producer(s)RissiLukas Graham singles chronology Love Songs (2020) Share That Love (2020) Where I'm From (2020) G-Eazy singles chronology Bounce Back(2020) Share That Love(2020) Down(2020) Share ...

 

Yugoslav politician Božidar Adžija Božidar Adžija (Serbian Cyrillic: Божидар Аџија; 24 December 1890 – 9 July 1941) was a Yugoslav communist politician and publicist. Biography A native of Drniš in the Kingdom of Dalmatia (present-day Croatia), of Croat and Serb descent, Adžija participated in World War I as a soldier in Austro-Hungarian Army. Prior to that, he went to Prague to study law, completing his doctorate in 1914.[1] After the war and collapse of Austria-H...

У Вікіпедії є статті про інших людей із прізвищем Гардінг. Саманта ГардінгSamantha HardingЗагальна інформаціяГромадянство  КанадаНародження 31 травня 1994(1994-05-31) (29 років)Брендон, Манітоба, КанадаСпортВид спорту спортивне плавання Участь і здобутки Саманта Гардінг (англ. Samantha H...

 

Presiden India, Dr. A.P.J. Abdul Kalam memberikan penghargaan Padma Bhushan kepada Ketua Cancer Institute, Chennai, Dr. V. Shanta, di New Delhi pada 20 Maret 2006 V. Shanta (11 Maret 1927 – 19 Januari 2021)[1] adalah ahli onkologi India dan ketua Adyar Cancer Institute, Chennai. Ia terkenal karena upayanya membuat pengobatan kanker yang berkualitas dan terjangkau dapat diakses oleh semua pasien di negaranya.[2][3] Ia mendedikasikan dirinya untuk misi me...

 

Indian space researcher This article is an orphan, as no other articles link to it. Please introduce links to this page from related articles; try the Find link tool for suggestions. (October 2023) M. SankaranM Sankaran at Rajah Serfoji Government College, March 2019Born (1964-08-08) 8 August 1964 (age 59)Enkan, Thiruvarur, Tamil Nadu, IndiaAlma mater Thanthai Periyar Government College of Arts and Sciences Rajah Serfoji Government College, Thanjavur OccupationDirectorYears act...

Chief legal officer of Washington, D.C. Not to be confused with United States Attorney for the District of Columbia. Attorney General of the District of ColumbiaSeal of the Office of the Attorney GeneralIncumbentBrian Schwalbsince January 2, 2023Term lengthFour years, renewableFormation1973WebsiteOffice of the Attorney General Politics of District of Columbia The District of Columbia is a unique federal district of the U.S. Governance Government Home rule Mayor Secretary United States At...

 

American attorney and political advisor (born 1978) Maju VargheseDirector of the White House Military OfficeIn officeMarch 9, 2021 – January 21, 2022PresidentJoe BidenPreceded byKeith DavidsSucceeded byTBDDirector of the White House Office of Management and AdministrationIn officeJuly 2015 – January 20, 2017PresidentBarack ObamaPreceded byKaty KaleSucceeded byMarcia L. Kelly Personal detailsBorn (1978-02-21) February 21, 1978 (age 45)New York City, New York, U.S.Edu...

 

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: The Sagamore – news · newspapers · books · scholar · JSTOR (May 2018) (Learn how and when to remove this template message) United States historic placeThe Sagamore ResortU.S. National Register of Historic Places Lakeside view of the Sagamore HotelNearest cityBo...

Ambassador of the United States to LuxembourgSeal of the United States Department of StateIncumbentTom Barrettsince February 10, 2022ResidenceDolibois HouseNominatorThe President of the United StatesAppointerThe Presidentwith Senate advice and consentInaugural holderStanford Newelas EnvoyFormation1903WebsiteU.S. Embassy – Luxembourg The United States ambassador to Luxembourg oversees the U.S. Embassy in that country. They supervise the embassy staff in the conduct of diplomatic relatio...

 

National basketball championship in Latvia Latvian Basketball LeagueLatvijas Basketbola līga (LBL)SportBasketballFounded1992No. of teams6CountryLatviaContinentFIBA EuropeMost recentchampion(s)VEF Riga (10th title)Most titlesVentspilsVEF Riga(10 each)TV partner(s)Latvia: LTV7, TV4 Level on pyramid1st tierOfficial websitebasket.lv The Latvian Basketball League (LBL; Latvian: Latvijas Basketbola līga) also known as the Pafbet LBL for sponsorship reasons,[1] is the national basketball c...

 

Commune in Satu Mare, RomaniaCălinești-OașCommuneLocation in Satu Mare CountyCălinești-OașLocation in RomaniaCoordinates: 47°55′13″N 23°17′11″E / 47.92028°N 23.28639°E / 47.92028; 23.28639CountryRomaniaCountySatu MareGovernment • Mayor (2020–2024) Dinu Birtoc[1] (PNL)Area41.88 km2 (16.17 sq mi)Population (2021-12-01)[2]5,117 • Density120/km2 (320/sq mi)Time zoneEET/EEST (UTC+2/+3)V...

Le Leuycomune Le Leuy – Veduta LocalizzazioneStato Francia Regione Nuova Aquitania Dipartimento Landes ArrondissementDax CantonePays morcenais tarusate TerritorioCoordinate43°49′23″N 0°39′05″W / 43.823056°N 0.651389°W43.823056; -0.651389 (Le Leuy)Coordinate: 43°49′23″N 0°39′05″W / 43.823056°N 0.651389°W43.823056; -0.651389 (Le Leuy) Altitudine66 m s.l.m. Superficie9,63 km² Abitanti222[1] (2009)...

 

American TV series or program The Green Room with Paul ProvenzaGenreTalk showCreated byPaul ProvenzaDirected byMichael Franks, Barbara RomenStarringProvenza and panelOpening themeSomebody Start a Fight or Something by TISMCountry of originUnited StatesOriginal languageEnglishNo. of seasons2No. of episodes14ProductionExecutive producersBarbara RomenPaul ProvenzaProduction locationsThe Vanguard, Hollywood, CARunning time30 minOriginal releaseNetworkShowtimeReleaseJune 10, 2010 (2010-0...

 

Rotherham InterchangeGeneral informationLocationFrederick Street, Rotherham town centreRotherham (S60 1QB)EnglandCoordinates53°26′01″N 1°21′24″W / 53.4336°N 1.3567°W / 53.4336; -1.3567Owned bySouth Yorkshire Passenger Transport ExecutiveOperated byTravel South YorkshireBus stands24Bus operatorsFirst South Yorkshire, National Express, Powell's Bus, Stagecoach East Midlands, Stagecoach Yorkshire, TM TravelConnectionsRotherham Central station (400 m (1,30...

Piaggio MP5 PaperinoModello originale del 1944 costruito negli stabilimenti di BiellaCostruttore Piaggio TipoScooter Produzionedal 1944 al 1944 Sostituita daPiaggio MP6 Manuale Piaggio Paperino o MP5 Paperino (MP5 sta per Moto Piaggio 5) è un prototipo di motoscooter[1] (che potrebbe in un certo senso essere considerato il progenitore naturale, nonostante alcune sostanziali differenze, della Piaggio Vespa) predisposto dalla Piaggio durante la seconda guerra mondiale. In par...

 

Verónica Romero Información personalNombre de nacimiento Verónica Romero SotocaOtros nombres VeroNacimiento 18 de julio de 1978 (45 años) Elche, Alicante, EspañaResidencia Elche Nacionalidad EspañolaCaracterísticas físicasAltura 1,60 centímetros[1]​Ojos Pardos[1]​Cabello Rubio oscuro[1]​Información profesionalOcupación Cantante, compositora, música, actriz, productora y colaboradora de televisión y radio.Años activa 2001-presenteSeudónimo VeroGénero...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!