Read other articles:

Al-AhlyNama lengkapAl-Ahly Sporting ClubBerdiri1907StadionStadion Kairo(Kapasitas: 74.100)Ketua Mahmoud El KhatibManajer Martín LasarteLigaLiga Utama Mesir2022–23Liga Utama Mesir, posisi ke-1 Kostum kandang Kostum tandang Logo lama Al-Ahly S.C.. Al-Ahly Sporting Club merupakan sebuah tim sepak bola Mesir yang bermarkas di Kairo, Mesir. Klub ini biasanya dikatakan sebagai klub terpopuler di Mesir dengan 40 juta suporter. Gelar Liga Premier Mesir (43): 1948–1949, 1949–1950, 1950–1951, ...

 

Adesua Etomi Información personalNombre de nacimiento Tolulope Nacimiento 22 de febrero de 1986 (37 años)Owerri (Nigeria) Nacionalidad NigerianaLengua materna Esan Características físicasAltura 1,68 m Ojos Marrón castaño Cabello Cabello negro FamiliaCónyuge Banky W. Hijos 1 EducaciónEducación graduado universitario Educada en City College Coventry (Artes escénicas y Teatro)Queen's College, LagosUniversity of Wolverhampton (B.A. en Teatro; hasta 2009) Información prof...

 

Kirche Sacré-Coeur Basel Die Kirche Sacré-Cœur ist ein römisch-katholisches Kirchengebäude im Basler Quartier Am Ring (Feierabendstrasse 68). Sie wurde 1956 von den Basler Architekten Guerino Belussi und Raymond Tschudin für die französisch sprechenden Katholiken erbaut. Die Glasbilder schuf 1986 der Freiburger Maler Yoki. Der grosse, kreuzlose Bronze-Christus[1] von Georges Schneider[2] aus dem Erbauungsjahr der Kirche ist stark abweichend von der traditionellen Ikonog...

Варнава   Альма-матер: Московська духовна академія Діяльність: православний чернець, православний священник Ім'я при народженні: Микола Никанорович Беляєв Народження: 12 (25) травня 1887(1887-05-25) Раменське Смерть: 6 травня 1963(1963-05-06) (75 років) Київ Похований: Байкове кладовище

 

Artikel ini bukan mengenai Daftar Gubernur Papua. Gubernur Papua TengahLambangPetahanaRibka HalukPenjabatsejak 11 November 2022KediamanRumah Dinas Gubernur Papua TengahMasa jabatan5 tahunDibentuk12 Oktober 1999 (Irian Jaya Tengah)11 November 2022 (Papua Tengah)Pejabat pertamaHerman Monim Berikut ini adalah daftar Gubernur Papua Tengah sekaligus jabatan pendahulunya, Gubernur Irian Jaya Tengah. Daftar No. Potret Gubernur Mulai menjabat Akhir menjabat Partai Wakil Gubernur Gubernur Irian J...

 

AZ discographyAZ performing in Hamburg in 1997Studio albums10Compilation albums10Singles27 The discography of AZ, an American rapper, consists of 10 studio albums, one collaborative album, 10 compilation albums and 27 singles. Albums Studio albums List of studio albums, with selected chart positions Title Album details Peak chart positions US US R&B US Rap US Indie Doe or Die Released: October 10, 1995 Label: EMI Formats: CD, LP, Cassette, digital download 15 1 1 1 Pieces of a Man Release...

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

 

2004 superhero film directed by Sam Raimi For other uses, see Spider-Man 2 (disambiguation). Spider-Man 2Theatrical release posterDirected bySam RaimiScreenplay byAlvin SargentStory by Alfred Gough Miles Millar Michael Chabon Based onSpider-Manby Stan LeeSteve DitkoProduced by Laura Ziskin Avi Arad Starring Tobey Maguire Kirsten Dunst James Franco Alfred Molina Rosemary Harris Donna Murphy CinematographyBill PopeEdited byBob MurawskiMusic byDanny ElfmanProductioncompanies Columbia Pictures ...

 

Overview of the folklore of the Turkish peoples This article includes a list of references, related reading, or external links, but its sources remain unclear because it lacks inline citations. Please help to improve this article by introducing more precise citations. (April 2009) (Learn how and when to remove this template message) Part of a series on theCulture of Turkey History Anatolian peoples Genetic history Migration of Turks into Anatolia Constitutional history Diplomatic history Econ...

Sporting event delegationCyprus at the2010 Winter OlympicsIOC codeCYPNOCCyprus Olympic CommitteeWebsitewww.olympic.org.cy/index.php/gr/ (in Greek)in VancouverCompetitors2 in 1 sportFlag bearers Christopher Papamichalopoulos (opening)Sophia Papamichalopoulou (closing)Medals Gold 0 Silver 0 Bronze 0 Total 0 Winter Olympics appearances (overview)198019841988199219941998200220062010201420182022 Cyprus sent a delegation to compete at the 2010 Winter Olympics in Vancouver, British Columbi...

 

Migratory Bird Sanctuary in British Columbia, Canada The Esquimalt Lagoon Migratory Bird Sanctuary is a migratory bird sanctuary near Esquimalt Harbour in Colwood, British Columbia. The Esquimalt Lagoon is found on the traditional territories of the Esquimalt and Songhees Nations.[1] The park was established in 1931 with the objective of creating a safe haven for migratory birds,[2] and has become a popular place for birdwatching.[3] Many other species can be found wit...

 

Darley Dale is a civil parish in the Derbyshire Dales district of Derbyshire, England. The parish contains 27 listed buildings that are recorded in the National Heritage List for England. Of these, three are listed at Grade II*, the middle of the three grades, and the others are at Grade II, the lowest grade. The parish contains the town of Darley Dale and the surrounding area. Most of the listed buildings are houses, cottages and associated structures, farmhouses and farm buildings. The othe...

Bilateral relationsArgentine–Mexican relations Argentina Mexico Diplomatic relations between the Argentine Republic and the United Mexican States, have existed for over a century. Both nations are members of the Community of Latin American and Caribbean States, G-20 major economies, Latin American Integration Association, Organization of American States, Organization of Ibero-American States and the United Nations. History Mexican President Adolfo López Mateos on a state visit to Argentina...

 

1991 American film by Mick Jackson This article is about the film. For the song, see L.A. Story (song). L.A. StoryTheatrical release posterDirected byMick JacksonWritten bySteve MartinProduced by Daniel Melnick Mario Kassar Starring Steve Martin Victoria Tennant Richard E. Grant Marilu Henner CinematographyAndrew DunnEdited by Richard A. Harris Greg Le Duc Music byPeter MelnickProductioncompanyCarolco PicturesDistributed byTri-Star PicturesRelease date February 8, 1991 (1991-02...

 

For related races, see 2014 United States gubernatorial elections. 2014 Alabama gubernatorial election ← 2010 November 4, 2014 2018 →   Nominee Robert J. Bentley Parker Griffith Party Republican Democratic Popular vote 750,231 427,787 Percentage 63.6% 36.2% County resultsBentley:      50–60%      60–70%      70–80%      80–90%Griffith:    &...

BugzillaPengembangMozilla FoundationRilis perdana26 Agustus 1998; 25 tahun lalu (1998-08-26)[1]Rilis stabil5.0.6 (9 Februari 2019; 4 tahun lalu (2019-02-09)) [±] Repositorigithub.com/bugzilla/bugzilla Bahasa pemrogramanPerlSistem operasiCross-platformTersedia dalamMultiple languagesJenisBug tracking systemLisensiMozilla Public LicenseSitus webwww.bugzilla.org Bugzilla adalah sebuah perangkat lunak untuk penanganan bug yang awalnya dikembangkan dan digunakan oleh...

 

You can help expand this article with text translated from the corresponding article in French. (April 2023) Click [show] for important translation instructions. View a machine-translated version of the French article. Machine translation, like DeepL or Google Translate, is a useful starting point for translations, but translators must revise errors as necessary and confirm that the translation is accurate, rather than simply copy-pasting machine-translated text into the English Wikipedi...

 

2014 concert tour by Little Mix Salute TourTour by Little MixPromotional poster for the tourLocationEuropeAssociated albumSaluteStart date16 May 2014 (2014-05-16)End date27 July 2014 (2014-07-27)Legs1No. of shows20Box office$10.6 millionLittle Mix concert chronology DNA Tour(2013) The Salute Tour(2014) The Get Weird Tour(2016) The Salute Tour was the second concert tour held by British girl group Little Mix, in support of their second studio album, Salute. The to...

Street in Kyoto, Japan Sanjō Street(三条通 さんじょうどおり sanjō dōri[1])is a major street that crosses the center of the city of Kyoto from east to west, running from Shinomiya in the Yamashina-ku ward (east) to the vicinity of the Tenryū-ji in Arashiyama (west).[2] History The street corresponds to the Sanjō Ōji street of the Heian-kyō, being at that time 30 meters wide.[3] During the Muromachi period the Sanjō Bridge was constructed in order ...

 

بطولة آسيا للشباب لكرة القدم 1977معلومات عامةالرياضة كرة القدم الفترة 1977 البداية 15 أبريل 1977 النهاية 28 أبريل 1977 البلد إيران عدد الجولات 23 الفرق المشاركة 13 عدد الأهداف 72 المواسمبطولة آسيا للشباب 1976 بطولة آسيا للشباب لكرة القدم 1978 تعديل - تعديل مصدري - تعديل ويكي بيانات بطولة آس...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!