Ellen Gandy
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
.svg){kind=small}
Read other articles:
En este artículo se detectaron varios problemas. Por favor, edítalo y/o discute los problemas en la discusión para mejorarlo: Necesita ser wikificado conforme a las convenciones de estilo de Wikipedia. Carece de fuentes o referencias que aparezcan en una fuente acreditada. Podría ser demasiado largo, y algunos navegadores podrían tener dificultades al mostrar este artículo. No se cumplen las reglas de ortografía, gramática o los estándares definidos en el Manual de estilo de Wikipedi...
Ne doit pas être confondu avec Mahmoud II. Pour les articles homonymes, voir Mohammed II (homonymie). Mehmed II Portrait de Mehmed II par Gentile Bellini (1479). Titre 7e sultan Ottoman août 1444 – septembre 1446(2 ans et 1 mois) Prédécesseur Mourad II Successeur Mourad II 3 février 1451 – 3 mai 1481(30 ans et 3 mois) Prédécesseur Mourad II Successeur Bayezid II Biographie Dynastie Dynastie ottomane Nom de naissance محمد الثاني بن مراد الثاني Da...
Cantón de Tavernes Cantón Situación del cantón de Tavernes Coordenadas 43°36′00″N 6°01′00″E / 43.6, 6.016667Capital TavernesEntidad Cantón • País Francia • Región Provenza-Alpes-Costa Azul • Departamento Var • Distrito BrignolesÚltimo consejero general Louis Reynier (2011-2015)Subdivisiones Comunas 7Superficie • Total 205.93 km²Población (2010) • Total 5633 hab. • Densidad 27,35 ...
Tom van Weert Plaats uw zelfgemaakte foto hier Persoonlijke informatie Volledige naam Tom van Weert Geboortedatum 7 juni 1990 Geboorteplaats Sint-Michielsgestel, Nederland Lengte 180 cm Been rechts Positie Spits, Schaduwspits Clubinformatie Huidige club AEK Athene Rugnummer 9 Contract tot 30 juni 2024 Jeugd 0000–2008 RKVV Sint-Michielsgestel FC Den Bosch Senioren * Seizoen Club W 0(G) 2008–20142014–20162016–20182018–20212021–20222022– FC Den Bosch Excelsior FC Groningen Aalborg ...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Zoop TV series – news · newspapers · books · scholar · JSTOR (May 2019) (Learn how and when to remove this template message) Dutch TV series or program ZoopZoop CastGenreFamilyComedyDramaWritten bySander DonkerJohan NijenhuisDirected byJohan Nijenhuis...
Chimerica adalah sebuah neologisme dan lakuran yang dicetuskan oleh Niall Ferguson dan Moritz Schularick untuk menyebut hubungan simbiotik antara Tiongkok dan Amerika Serikat, dengan rujukan kepada makhluk legenda chimera.[1][2][3][4][5] Meskipun istilah tersebut banyak merujuk kepada ekonomi, terdapat juga unsur politik. Referensi ^ Archived copy (PDF). Diarsipkan dari versi asli (PDF) tanggal 2010-06-13. Diakses tanggal 2009-08-18. ^ Moritz Schu...
Studio album by Franco D'AndreaSolo 5: DukeStudio album by Franco D'AndreaRecordedApril 2001GenreJazzLabelPhilology Solo 5: Duke is a solo piano album by Franco D'Andrea. Consisting mainly of performances of early Duke Ellington compositions, the album was recorded in 2001 and released by Philology Records. Recording and music Material for this and seven other solo piano CDs was recorded over the period of three mornings and two afternoons in April 2001.[1] The compositions ar...
Boxing competition in 2003 Battle of the TitansDateJune 21, 2003VenueStaples Center, Los Angeles, California, U.S.Title(s) on the lineWBC, IBO, and The Ring heavyweight titlesTale of the tapeBoxer Lennox Lewis Vitali KlitschkoNickname The Lion Dr. IronfistHometown London, England Belovodskoye, Kirghiz SSR, Soviet Union (now Kyrgyzstan)Pre-fight record 40–2–1 (31 KO) 32–1 (31 KO)Height 6 ft 5 in (196 cm) 6 ft 7 in (201 cm)Weight 256+1⁄2 lb (116...
1931 talk by J. R. R. Tolkien A Secret Vice 2016 critical edition coverEditorsDimitra Fimi Andrew HigginsAuthorJ.R.R. TolkienCountryUnited KingdomLanguageEnglishSubjectsConlanging, Linguistics, PhilologyPublished7 April 2016PublisherHarperCollinsMedia typeHardbackPages300ISBN978-0-00-813139-5 A Secret Vice, also known as A Hobby for The Home, is the title of a lecture first presented by English philologist and author J. R. R. Tolkien in 1931. The lecture concerns Tolkien's relations with...
NA-250 Karachi Central-IVConstituencyfor the National Assembly of PakistanRegionNazimabad Town (partly) and North Nazimabad Town of Karachi Central District in KarachiElectorate489,665Current constituencyMember(s)VacantCreated fromNA-256 Karachi Central-IV NA-250 Karachi Central-IV (این اے-250، کراچی وسطی-4) is a constituency for the National Assembly of Pakistan that covers North Nazimabad.[1][2] Members of Parliament 2018-2023: NA-256 Karachi Central-IV Electi...
Genre of classical music Music of Russia Genres Classical Opera Pop Rock Hip hop Specific forms Religious music Bell ringing Liturgical Znamenny Traditional music Ethnic Russian music Dumka Romance Popular music Bard Chanson Dark psytrance Drift phonk Hardbass Hookah rap Sovietwave VIA Media and performance Music awards Pesnya Goda MTV RMA RAMP Golden Gramophone Ovation Russian National Music Award Music charts Zvukovaya Dorozhka MK Chart Dozen Music festivals Grushinsky Nashestvie Afisha Pic...
This article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Desert combat boot – news · newspapers · books · scholar · JSTOR (September 2014) (Learn how and when to remove this template message) Beige desert boots in the sand A desert combat boot is a type of combat boot designed specifically for use in humid or arid regions for desert w...
Pertarungan antara Boma dan Krisna, Museum Puri Lukisan, Bali. Lukisan-lukisan Bali terkenal dengan detail yang rumit dan penuh. Horror vacui (/ˈhɒrər ˈvɑːkjuːaɪ/; dari bahasa Latin ketakutan akan ruang kosong) atau kenofobia (dari bahasa Yunani ketakutan akan yang kosong)[1] dalam seni rupa adalah pengisian seluruh permukaan sebuah bidang atau karya seni dengan ornamen.[2] Dalam fisika, horror vacui merupakan ejawantah dari gagasan Aristoteles bahwa alam membenci ruan...
Virginia Prince Fotografía de Virginia Prince, activista transgéneroInformación personalNacimiento 23 de noviembre de 1912Los Ángeles, CaliforniaFallecimiento 2 de mayo de 2009Los Ángeles CaliforniaNacionalidad EstadounidenseFamiliaHijos 1 EducaciónEducada en Universidad de California, San FranciscoInformación profesionalOcupación Escritora de no ficción, química y activista LGBTI [editar datos en Wikidata] Virginia Charles Prince (Los Ángeles 23 de noviembre de 1912 - ib...
هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (نوفمبر 2015) mannose receptor, C type 2 المعرفات الرمز MRC2 رموز بديلة CD280 أنتريه 9902 HUGO 16875 RefSeq NM_006039 يونيبروت Q9UBG0 بيانات أخرى الموقع الكروموسومي Chr. 17 q23 تعديل مصدري - تعديل إندو180 (ب...
The Conception Bay Sports Arena, also known as the Bay Roberts Arena, was an open-air ice arena with an artificial ice surface located in Bay Roberts, Newfoundland and Labrador, Canada. The arena was located on the Conception Bay highway at the hub of the communities of Bay Roberts, Coley's Point, Brigus, Shearstown, Harbour Grace and Carbonear. The rink had the first artificial ice surface in Conception Bay but was used less than three years from 1956 to 1958. History Fred Bennett, a busines...
Monte Foster Monte Foster, pico Evlogi, y pico Antim a la derecha.Localización geográficaContinente AntártidaRegión Isla SmithCordillera Sierra ImeonSierra Sierra ImeonCoordenadas 62°59′48″S 62°32′55″O / -62.996666666667, -62.548611111111Localización administrativaDivisión Región del Tratado AntárticoLocalización Isla Smith, Islas Shetland del Sur, AntártidaCaracterísticas generalesAltitud 2105 msnm[1]Prominencia 2105 m s. n. m.Montañismo1.ª ascen...
Village in Warmian-Masurian Voivodeship, PolandŁęgajnyVillageŁęgajnyCoordinates: 53°49′N 20°38′E / 53.817°N 20.633°E / 53.817; 20.633Country PolandVoivodeshipWarmian-MasurianCountyOlsztynGminaBarczewo Łęgajny [wɛnˈɡai̯nɨ] is a village in the administrative district of Gmina Barczewo, within Olsztyn County, Warmian-Masurian Voivodeship, in northern Poland.[1] It lies approximately 4 kilometres (2 mi) south-west of Barczewo and 10...
لمعانٍ أخرى، طالع سيدي سليمان (توضيح). سيدي سليمان خريطة البلدية الإحداثيات 33°50′00″N 1°43′50″E / 33.833333333333°N 1.7305555555556°E / 33.833333333333; 1.7305555555556 تقسيم إداري البلد الجزائر ولاية ولاية البيض دائرة دائرة بوعلام خصائص جغرافية المجموع 154٫10 كم2 (59٫...
Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!