JaJuan Johnson

JaJuan Johnson
Johnson with the Houston Rockets in 2012
No. 25 – Hapoel Eilat
PositionPower forward / center
LeagueIsraeli Premier League
Personal information
Born (1989-02-08) February 8, 1989 (age 35)
Indianapolis, Indiana, U.S.
Listed height6 ft 10 in (2.08 m)
Listed weight221 lb (100 kg)
Career information
High schoolFranklin Central
(Indianapolis, Indiana)
CollegePurdue (2007–2011)
NBA draft2011: 1st round, 27th overall pick
Selected by the New Jersey Nets
Playing career2011–present
Career history
2011–2012Boston Celtics
2012Fort Wayne Mad Ants
2012–2013Canton Charge
2013Idaho Stampede
2013–2014Pistoia
2014Changsha Bank Guangdong
2014–2015Beşiktaş
2015Krasny Oktyabr
2015–2017Cantù
2017–2018Darüşşafaka
2018–2019Lokomotiv Kuban
2019–2020Bahçeşehir Koleji
2020–2021Bayern Munich
2021–2022Türk Telekom
2022–2023BCM Gravelines-Dunkerque
2023–2024New Basket Brindisi
2024–presentHapoel Eilat
Career highlights and awards
Stats at NBA.com Edit this at Wikidata
Stats at Basketball Reference Edit this at Wikidata

JaJuan Markeis Johnson (born February 8, 1989) is an American professional basketball player for Hapoel Eilat of the Israeli Basketball Premier League. He played college basketball at Purdue University. During his sophomore season, he was named a first-team All-Big Ten selection. As a junior, he was named a second-team All-Big Ten selection. As a senior, a first-team consensus All-American as well as the Big Ten Player of the Year and Big Ten Defensive Player of the Year.

High school career

Johnson was born in Indianapolis, Indiana. He attended Franklin Central High School in Indianapolis, where he played for head coach Mark James. Tall for his age, Johnson played on the B-team in the 7th and 8th grade. He finished his senior year averaging 20.6 points and 9.1 rebounds a game for the Flashes. Johnson was named to the Indiana All-Star Team with future NBA players, Eric Gordon, Jeff Teague, Robbie Hummel, and E'Twaun Moore.

Considered a four-star recruit by Rivals.com, Johnson was listed as the No. 9 power forward and the No. 42 player in the nation in 2007.[1]

College career

2007–08

The 6'10", 215 lb forward/center committed to the Purdue University Boilermakers to play under head coach Matt Painter as part of a top five recruiting class, along with fellow Indiana All-Stars Robbie Hummel, E'Twaun Moore and Scott Martin. He averaged 5.4 points and 3.1 rebounds a game, while starting in 17 of the 34 games in which he appeared in during his freshman season. He helped the Boilermakers to a second straight NCAA tournament appearance, including a game against Baylor in the first round, where he scored 10 points, grabbed 8 rebounds and blocked 2 shots in 20 minutes.[2]

2008–09

Johnson averaged 13.4 points (second on team) and led the conference with 2.2 blocks a game, for which, he was named a First-Team All-Big Ten selection as well as to the Big Ten All-Defensive Team along with teammate, Chris Kramer. He also led the conference shooting 54 percent from the field. Johnson opened conference play with a 15 rebound effort against Illinois on December 30, 2008. On February 3, 2009, he recorded a career high 30 points at Ohio State and had his career 7 blocks in a game at Northwestern on January 15, 2009. He recorded five double-doubles on the season, all coming in conference play. Johnson led Purdue to the program's first Big Ten tournament championship and was named to the all-tournament team and helped lead them to a Sweet Sixteen appearance. In the second-round game in the NCAA Tournament against Washington in the last seconds, he blocked back-to-back shots to seal the win while adding 22 points and a total of 4 blocks. Finishing with a 27–10 record, he is one of four Boilermakers to share the school record for most games played in a season. He also moved amongst Joe Barry Carroll in the Purdue records with the third most blocks in a season with 78.

2009–10

E'Twaun Moore, Johnson and Robbie Hummel at press conference (2010-01-23)

Johnson considered entering the 2009 NBA draft, but made a verbal commitment to return for the junior year.[3][4] He began his junior season as a preseason first team all-Big Ten selection by CBS Sports. In the season, he recorded nine double-doubles, while leading Purdue to its best start in 16 years (14–0). Johnson was named the Big Ten Player of the Week in late January, averaging 22.5 points and 9.5 rebounds in two games (2–0). On February 9, 2010, Johnson recorded his 1,000th career point in a road game win against #10 ranked Michigan State. Finishing with a 14–4 record in conference play, Johnson led Purdue to its first Big Ten title in fourteen years, climaxing with a road win against Penn State, where he had 21 points, 10 rebounds, 3 blocks, and shot 11–14 at the line. In an average of 31.3 minutes a game, Johnson averaged 15.4 points (3rd on team), 7.3 rebounds (1st), and 1 steal per game. Johnson shot 72 percent at the line, while leading the top ten ranked Purdue squad with 2 blocks a game and shooting 51 percent from the floor. Johnson was named Second-Team All-Big Ten and received consecutive Big Ten All-Defensive Team honors at the end of the regular season. With Purdue receiving a 4 seed in the NCAA tournament, Johnson led the Boilermakers in the First Round victory against Siena, where he had 23 points, 15 rebounds, and 3 blocks, leading to consecutive Sweet Sixteen appearances after beating Texas A&M in overtime. In his final game of his junior season, Johnson had team highs with 23 points, making 10 of 17 attempts, while tallying 5 rebounds and 4 blocks in a losing effort against Duke. Johnson ended this junior season with the second most career blocks in school history with 184, after Joe Barry Carroll's 349 from 1977 to 1980. Johnson held the third highest average in school history with 1.7 blocks per game, behind Carroll and Russell Cross. He spent the following summer practicing with Team USA.

2010–11

Johnson, along with teammate E'Twaun Moore, entered the 2010 NBA draft, but withdrew and returned to school after scouts projected him as a second-round pick.[5] JaJuan entered his senior season as an AP preseason All-American.[6] He recorded twelve double-doubles on the season and recorded a career high of 31 points against Indiana State. On February 27, Johnson achieved career highs with 17 rebounds and 7 blocks against Michigan State. He scored in double-figures every game, which included twenty two 20+ games. JaJuan was named a Sporting News midseason first-team All-American, along with the likes of Nolan Smith, Jordan Hamilton, Kemba Walker, and fellow Big Ten player, Jared Sullinger. In his senior season, JaJuan was the only player in the nation with career numbers of more than 1,900 points, 850 rebounds, and 250 blocks. On March 7, Johnson was named Big Ten Player of the Year and also Big Ten Defensive Player of the Year, as well as being selected for the First Team All-Big Ten along with teammate E'Twaun Moore. He led the Big Ten in scoring and in blocks, as well as having the nation's highest scoring average for a player at the center position. With a 3 seed in the NCAA tournament, Purdue faced St. Peter's in the First Round, where JaJuan scored 16 points and grabbed a career postseason-high 16 rebounds. In his last game as a Boilermaker, JaJuan had 25 points and 14 rebounds against Virginia Commonwealth in an 18-point loss. JaJuan averaged 20.5 points (1st on team), 8.6 rebounds (1st), 2.3 blocks (1st), 1 assist, 1 steal, and shot 49.5 percent from the floor and 81 percent from the line (1st). He led Purdue to a 26–8 record and a 2nd-place finish in conference play in his last season as a Boilermaker and was named a Consensus first-team All-American,[7] Purdue's first since Glenn Robinson and seventeenth overall. He also became the first Boilermaker to be given the Pete Newell Big Man Award, an award given to the year's best big man.[8] He was picked to the First Team All-America by Fox Sports.[9]

Career notes

Johnson finished his career at Purdue as the seventh highest scorer in school history (1,919), averaging 13.7 points, 6.1 rebounds, 2 blocks, .7 assists, and .7 steals. He shares school records with games in a season (37), total games (140), and games won (107). He finished 2nd in school history in career blocks with 263, as well as tallying 854 rebounds. On November 29, 2011, Johnson appeared in dedication of the eleventh number-banner to be displayed at Mackey Arena, which displayed his last name and jersey #25 for being named a consensus All-American his senior season.

Professional career

Boston Celtics (2011–12)

JaJuan Johnson was drafted by the New Jersey Nets as the 27th pick in the 2011 NBA draft and subsequently traded to the Boston Celtics along with a 2014 second-round pick for the rights to MarShon Brooks.[10] Johnson received limited playing time throughout the course of the 2011–2012 season. On February 12, 2012, in a 95–91 win over the Chicago Bulls, Johnson shot 6-of-13 for a season-high 12 points to go along with four rebounds, two steals and a block.[11] The Celtics valued his raw talent, but inconsistency led to the lack of minutes he would see the rest of the season.[12]

D-League (2012–13)

On July 20, 2012, Johnson was traded to the Houston Rockets in a three team deal.[13] He was waived by the Rockets on October 29, 2012.[14]

On November 2, 2012, Johnson was selected by the Fort Wayne Mad Ants with the first pick in the 2012 NBA Development League Draft.[15][16]

On December 28, 2012, Johnson was traded to the Canton Charge in exchange for Luke Harangody.[17]

On February 25, 2013, Johnson was traded to the Idaho Stampede.[18]

Pistoia Basket (2013–14)

In August 2013, Johnson signed with Giorgio Tesi Pistoia of the Lega Basket Serie A; he helped lead them to an 8th-place finish in the league standings and a spot in the playoffs. While the team was bounced from the playoffs by eventual champion Milan, Johnson led the team in scoring in one playoff game and twice led them in rebounding.[19]

Beşiktaş (2014–15)

On June 23, 2014, it was announced that Johnson had signed with the Turkish team Beşiktaş Integral Forex for the 2014–15 Turkish Basketball League season. He joined Beşiktaş along with Engin Atsür and Caner Erdeniz.[20][21] He made his season debut on October 11, against Darüşşafaka S.K. and finished the game with 26 points, 7 rebounds, and 1 steal. Johnson, who shot 10-of-17 from the field, led his team in scoring and rebounding as a starting power forward. However, his team ultimately fell, 71–74.[22] Johnson continued to play a key role for Beşiktaş as he represented the team for the 2014–15 edition of the EuroCup Basketball. In a home game vs the Slovenian club KK Olimpija, he scored a game-high 20 points and ended with 8 rebounds and 5 steals.[23] On October 22, Johnson recorded the first double-double of his year in a Eurocup contest against B.C. Zenit Saint Petersburg. He went for 21 points and a game-high 12 rebounds in 39 minutes of playing time at Sibur Arena in Saint Petersburg, Russia.[24] Beşiktaş captured the victory, 90–86.[25]

Krasny Oktyabr (2015)

On July 31, 2015, Johnson signed with Krasny Oktyabr of Russia.[26] On November 23, 2015, he parted ways with the club.[27]

Pallacanestro Cantù (2015–17)

On November 26, 2015, he signed with the Italian club Pallacanestro Cantù.[28]

Darüşşafaka (2017–18)

On July 14, 2017, Johnson signed a two-year deal with the Turkish club Darüşşafaka.[29] On April 4, 2018, Johnson was named All-EuroCup Second Team.[30] Johnson helped Darüşşafaka to win the 2017–18 EuroCup title after beating Lokomotiv Kuban in the Finals. In 52 games played during the 2017–18 season (both in the EuroCup and all Turkish competitions), Johnson averaged 14.4 points, 6.2 rebounds, 1 assist and 1 block per game.

Lokomotiv Kuban (2018–2019)

On July 11, 2018, Johnson officially signed with the Russian team Lokomotiv Kuban for the 2018–19 season.[31]

Bahçeşehir Koleji (2019–2020)

On August 19, 2019, he has signed with Bahçeşehir Koleji of the Basketbol Süper Ligi (BSL).[32]

Bayern Munich (2020–2021)

On July 30, 2020, he has signed with Bayern Munich of the Basketball Bundesliga (BBL) and the Euroleague.[33]

Türk Telekom (2021–2022)

On August 3, 2021, he has signed with Türk Telekom of the Basketball Super League.[34]

BCM Gravelines-Dunkerque (2022–2023)

On June 25, 2022, he signed with BCM Gravelines-Dunkerque of the French LNB Pro A.[35]

New Basket Brindisi (2023–2024)

On July 9, 2023, he signed with New Basket Brindisi of the Lega Basket Serie A.[36]

Career statistics

Legend
  GP Games played   GS  Games started  MPG  Minutes per game
 FG%  Field goal percentage  3P%  3-point field goal percentage  FT%  Free throw percentage
 RPG  Rebounds per game  APG  Assists per game  SPG  Steals per game
 BPG  Blocks per game  PPG  Points per game  Bold  Career high

Regular season

Year Team GP GS MPG FG% 3P% FT% RPG APG SPG BPG PPG
2011–12 Boston 36 0 8.3 .446 .000 .667 1.6 .2 .1 .4 3.2
Career 36 0 8.3 .446 .000 .667 1.6 .2 .1 .4 3.2

References

  1. ^ JaJuan Johnson Recruiting Profile
  2. ^ "Perhaps the most improved player in college basketball, JaJuan Johnson now turns to the Sweet 16 – ESPN The Magazine". ESPN. March 26, 2009. Retrieved November 15, 2012.
  3. ^ "Purdue's Johnson emerges as star – Men's College Basketball – ESPN". ESPN. Associated Press. February 24, 2009. Retrieved December 26, 2011.
  4. ^ "Purdue big man JaJuan Johnson to stay for junior year – ESPN". ESPN.com. March 31, 2009. Retrieved December 26, 2011.
  5. ^ Katz, Andy (May 8, 2010). "No draft for Purdue's Johnson, Moore". ESPN.com.
  6. ^ "Purdue's Johnson named AP Preseason All-America". IndyStar.com. November 1, 2010. Retrieved November 17, 2013.
  7. ^ "Swanigan Completes an All-America Sweep". Journal and Courier. Lafayette, Indiana. March 29, 2017. p. C1 – via Newspapers.com.
  8. ^ "Johnson Receives Big Man Award". Journal and Courier. Lafayette, Indiana. April 3, 2011. p. 11 – via Newspapers.com.
  9. ^ Goodman, Jeff (March 7, 2011). "Goodman's 2010–11 All-America teams". Fox Sports. Fox Sports Interactive Media. Archived from the original on October 26, 2013. Retrieved June 21, 2011.
  10. ^ "Nets get G Brooks from Celtics in draft-day trade". Wall Street Journal. Associated Press. Archived from the original on June 27, 2011.
  11. ^ Forsberg, Chris (June 23, 2012). "Report Cards: Johnson, Moore – Boston Celtics Blog – ESPN Boston". Espn.go.com. Retrieved November 15, 2012.
  12. ^ Payne, Greg (July 18, 2012). "JaJuan Johnson knows consistency's key – Boston Celtics Blog – ESPN Boston". Espn.go.com. Retrieved November 15, 2012.
  13. ^ "Rockets Get Players And Pick In Three-Team Deal". NBA.com. July 20, 2012. Retrieved July 20, 2012.
  14. ^ "Rockets waive Shaun Livingston, Jon Brockman, Gary Forbes, Lazar Hayward, JaJuan Johnson". Archived from the original on April 21, 2015. Retrieved October 30, 2012.
  15. ^ 2012 NBA D-League Draft Archived 2012-11-05 at the Wayback Machine
  16. ^ Fort Wayne Mad Ants Select JaJuan Johnson With First Pick of 2012 NBA Development League Draft Archived 2012-11-06 at the Wayback Machine
  17. ^ Charge Acquire Johnson & 1st Round Pick From Mad Ants Archived 2016-01-25 at the Wayback Machine
  18. ^ IDAHO ACQUIRES FARRAKHAN, JOHNSON Archived 2013-03-07 at the Wayback Machine
  19. ^ Giorgio Tesi Pistoia announced JaJuan Johnson
  20. ^ "Engin Atsür, Caner Erdeniz ve Jajuan Johnson Beşiktaş'ta". BJR.com.tr (in Turkish). Retrieved March 22, 2015.
  21. ^ "Eagles boost roster with 3 new players". BJK.com.tr. Retrieved March 22, 2015.
  22. ^ "Besiktas Integral Forex Istanbul 71, Darussafaka Dogus Istanbul 74". RealGM. Retrieved March 22, 2015.
  23. ^ "Union Olimpija 70, Besiktas Integral Forex". RealGM. Retrieved March 22, 2015.
  24. ^ "Besiktas Integral Forex Istanbul 90, Zenit Saint Petersburg 86". RealGM. Retrieved March 22, 2015.
  25. ^ "Zenit St Petersburg vs Besiktas Integral Forex Istanbul". Eurocup Basketball. Retrieved March 22, 2015.
  26. ^ "Krasny Oktyabr signs JaJuan Johnson". Sportando.com. July 31, 2015. Retrieved July 31, 2015.
  27. ^ "Jordan Hamilton and JaJuan Johnson leave Krasny Oktyabr". Sportando.com. November 23, 2015. Retrieved November 23, 2015.
  28. ^ "Pallacanestro Cantù announces JaJuan Johnson". Sportando.com. November 26, 2015. Retrieved November 26, 2015.
  29. ^ "Darussafaka signs Johnson at power forward". eurocupbasketball.com. July 14, 2017. Archived from the original on July 17, 2017. Retrieved July 14, 2017.
  30. ^ "2017-18 All-7DAYS EuroCup Second Team". eurocupbasketball.com. April 4, 2018. Archived from the original on April 6, 2018. Retrieved April 6, 2018.
  31. ^ "Lokomotiv lands All-EuroCup forward Johnson". eurocupbasketball.com. July 11, 2018. Archived from the original on July 11, 2018. Retrieved July 11, 2018.
  32. ^ Carchia, Emiliano (August 19, 2019). "JaJuan Johnson agreed to terms with Bahcesehir". Sportando. Retrieved August 19, 2019.
  33. ^ Maggi, Alessandro (July 30, 2020). "JaJuan Johnson is a newcomer at Bayern Munich". Sportando. Retrieved July 30, 2020.
  34. ^ "RESMİ: Telekom'dan Johnson Takviyesi Geldi" (in Turkish). basketservisi. August 3, 2021. Retrieved August 3, 2021.
  35. ^ "JaJuan Johnson rejoint le BCM ! - BCM" (in French). June 25, 2022. Retrieved June 26, 2022.
  36. ^ Maggi, Alessandro (July 9, 2023). "Happy Casa Brindisi officially signs JaJuan Johnson". Sportando. Retrieved July 23, 2023.

Read other articles:

Questa voce sull'argomento società di pallacanestro greche è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. A.O. AigaleōPallacanestro Segni distintivi Uniformi di gara Casa Trasferta Colori sociali Bianco e azzurro Dati societari Città Egaleo Nazione  Grecia Confederazione FIBA Europe Federazione HEBA Campionato B Ethniki Fondazione 1956 Denominazione A.O. Aigaleō(1956-presente) Impianto Egaleo Indoor Hall(2,000 posti) Sito web www.aigaleobc.gr...

 

Tomislavo I di CroaziaStatua equestre di Tomislavo I di Croazia di Robert Frangeš Mihanović, ZagabriaRe dei CroatiIn carica925 - 928 Incoronazione925 a Duvno Predecessoresé stesso come Duca dei Croati SuccessoreTrpimir II Duca dei CroatiIn carica921 - 925 PredecessoreMuncimir di Croazia Successoresé stesso come Re dei Croati Morte928 PadreMuncimir di Croazia Tomislao I, o Tomislav (... – 928), fu un sovrano di Croazia durante il Medioevo. Regnò dal 910 al 928, dapprima come duca ...

 

У Вікіпедії є статті про інших людей з таким прізвищем: див. Зайченко. Зайченко Василь Андріанович Народження 26 березня (8 квітня) 1912Одеса, Херсонська губернія, Російська імперіяСмерть 7 червня 1985(1985-06-07) (73 роки)  Одеса, Українська РСР, СРСРПоховання ОдесаКраїна  Росій...

State legislature of Mizoram, India Mizoram Legislative Assembly8th Mizoram AssemblyTypeTypeUnicameral Term limits5 yearsLeadershipGovernor of MizoramKambhampati Hari Babu since 19 July 2021 Speaker of the HouseLalrinliana Sailo, BJP since 17 December 2018 Deputy Speaker of the HouseH. Biakzaua, MNF since 08 February 2023 Chief MinisterZoramthanga, MNF since 15 December 2018 Leader of the HouseZoramthanga(Chief Minister), MNF since 15 December 2018 Deputy Leader of the HouseTa...

 

E. Goujon Rechtsform Gründung 1896 Auflösung 1901 Sitz Neuilly-sur-Seine, Frankreich Branche Automobilindustrie Goujon 3.5 CV (1898) Goujon Einzylindermotor 3.5 PS (1898) E. Goujon war ein französischer Hersteller von Automobilen.[1][2][3] Inhaltsverzeichnis 1 Unternehmensgeschichte 2 Fahrzeuge 3 Literatur 4 Weblinks 5 Einzelnachweise Unternehmensgeschichte Das Unternehmen aus Neuilly-sur-Seine begann 1896 mit der Produktion von Automobilen. Der Markenname lautete G...

 

Carl Gustav JungJung ca. 1935LahirKarl Gustav Jung(1875-07-26)26 Juli 1875Kesswil, Thurgau, SwissMeninggal6 Juni 1961(1961-06-06) (umur 85)Küsnacht, Zürich, SwissAlmamaterUniversitas BaselDikenal atasPencetus psikologi analitisSuami/istriEmma Rauschenbach ​ ​(m. 1903; meninggal 1955)​Anak5PenghargaanGelar doktor kehormatan dari Universitas ClarkUniversitas FordhamUniversitas HarvardUniversitas AllahabadUniversitas BenaresUniversitas Kalku...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (يوليو 2020) جين كوك رايت معلومات شخصية اسم الولادة (بالإنجليزية: Jane Cooke Wright)‏  الميلاد 20 نوفمبر 1919  مانهاتن  الوفاة 19 فبراير 2013 (93 سنة) [1]  غوتنبرغ (نيوجيرسي)&#...

 

Indian Malayalam-language television channel Television channel Kairali TVTypeTelevision channelCountryIndiaHeadquartersThiruvananthapuramProgrammingLanguage(s)MalayalamPicture format480p SDOwnershipOwnerKairali TV NetworkKey peopleJohn Brittas (Managing Director)Mammootty (Chairman)Sister channelsKairali WEKairali NewsHistoryLaunched17 August 2000; 23 years ago (2000-08-17) (ചിങ്ങം 1)AvailabilityStreaming mediaJio TV(India)SD Kairali TV is an Indian Malayalam la...

 

هذه مقالة غير مراجعة. ينبغي أن يزال هذا القالب بعد أن يراجعها محرر مغاير للذي أنشأها؛ إذا لزم الأمر فيجب أن توسم المقالة بقوالب الصيانة المناسبة. يمكن أيضاً تقديم طلب لمراجعة المقالة في الصفحة المخصصة لذلك. (سبتمبر 2023) الأدب[1] الفرنسي في القرن التاسع عشر يتعلق الأدب الف...

Lis NilheimLahirKaren Lis Nilheim5 Juni 1944 (umur 79)Stockholm, SwediaKebangsaanSwediaPekerjaanPemeranTahun aktif1964-kiniPasanganLars Göran Carlson (1966-)[1] Karen Lis Nilheim (lahir 5 Juni 1944) adalah seorang pemeran asal Swedia.[2] Ia memenangkan penghargaan untuk Aktris Terbaik di Penghargaan Guldbagge ke-11 untuk perannya dalam Maria.[3] Ia tampil dalam lebih dari 45 film dan acara televisi sejak 1964. Filmografi pilihan Äktenskapsbrottaren (1964) M...

 

الدوري الهولندي الممتاز تفاصيل الموسم 1962-1963 النسخة 7  البلد هولندا  التاريخ بداية:27 أغسطس 1962  نهاية:16 يونيو 1963  المنظم الاتحاد الملكي الهولندي لكرة القدم  البطل نادي آيندهوفن مباريات ملعوبة 240   عدد المشاركين 16   الدوري الهولندي الممتاز 1961-1962 الدوري الهولند...

 

Cuplikan Dialog Terkait Dua Sistem Utama Dunia, oleh Galileo Galilei. Artikel ini perlu dikembangkan agar dapat memenuhi kriteria sebagai entri Wikipedia.Bantulah untuk mengembangkan artikel ini. Jika tidak dikembangkan, artikel ini akan dihapus. Dialog atau cakapan (serapan dari Belanda: dialoog, dari bahasa Yunani: διάλογος, translit. diálogos, har. 'percakapan')[1][2] adalah sebuah literatur dan teatrikal yang terdiri dari percakapan secar...

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

 

Professional disbanded wrestling tag team Professional wrestling tag team The Public EnemyThe Public Enemy, Rocco Rock (left) & Johnny Grunge (right)Tag teamMembersJohnny Grunge[1]Rocco Rock[1]Name(s)The Public EnemyThe South Philly PosseBilled heights6 ft 3 in (1.91 m) – Grunge[2]6 ft 2 in (1.88 m) – Rock[3]Combinedbilled weight514 lb (233 kg)HometownCompton, California[4]South PhiladelphiaDebut1993[1...

 

Durasi Penyinaran Matahari atau Lama Penyinaran Matahari ataupun Durasi Sinaran Matahari merupakan suatu indikator klimatologis untuk mengukur durasi atau lamanya penyinaran matahari pada suatu periode tertentu (biasanya sehari atau setahun) di suatu lokasi tertentu di Bumi, biasanya dinyatakan dalam bentuk nilai rerata selama beberapa tahun. Hal ini juga merupakan indikator pengukur keadaan berawan suatu wilayah dan karenanya berbeda dengan insolasi yang mengukur jumlah radiasi atau energi s...

Secretaria de Fazenda Avenida Desembargador José Nunes da Cunha, s/n - Parque dos Poderes, bloco 2Campo Grande, MSSefaz-MS Criação 1 de janeiro de 1979 (44 anos) Atual secretário Felipe Mattos A Secretaria de Estado de Fazenda de Mato Grosso do Sul (Sefaz) é o órgão estadual que executa a política econômica e fiscal do estado, além de elaborar e acompanhar a execução do orçamento. É uma das nove secretarias que integram o Governo de Mato Grosso do Sul[1]. História Foi ...

 

The Red Lion The Red Lion is a grade II listed public house and former hotel on the Great North Road, Hatfield, in Hertfordshire. The building dates from the late eighteenth century with nineteenth century additions and a large 1950s rear extension.[1] On 4 January 1970 The Who drummer Keith Moon accidentally killed his friend, driver and bodyguard, Neil Boland, outside the pub. Patrons had begun to attack his Bentley and Moon, drunk, began driving to escape them. During the fracas, h...

 

AirportBarretos–Chafei Amsei State AirportAeroporto Estadual de Barretos–Chafei AmseiIATA: BATICAO: SNBASummaryAirport typePublicOperator DAESP (?–2021) ASP (2021–present) ServesBarretosTime zoneBRT (UTC−03:00)Elevation AMSL579 m / 1,900 ftCoordinates20°35′08″S 048°35′45″W / 20.58556°S 48.59583°W / -20.58556; -48.59583MapBATLocation in BrazilRunways Direction Length Surface m ft 08/26 1,800 5,906 Asphalt Statistics (2012)Passengers4...

For the Derek Landy novel of the same name, see Skulduggery Pleasant: The Faceless Ones. 1967 Doctor Who serial035 – The Faceless OnesDoctor Who serialCastDoctor Patrick Troughton – Second Doctor Companions Anneke Wills – Polly Michael Craze – Ben Jackson Frazer Hines – Jamie McCrimmon Others Colin Gordon – Commandant Donald Pickering – Blade Wanda Ventham – Jean Rock Pauline Collins – Samantha Briggs Bernard Kay – Inspector Crossland George Selway – Meadows Gill...

 

Untuk pemain kriket Inggris, lihat Christopher Chaplin (pemain kriket). Christopher ChaplinChristopher Chaplin (2017)LahirChristopher James Chaplin6 Juli 1962 (umur 61)Corsier-sur-Vevey, SwissPekerjaanKomposer dan aktorOrang tuaCharlie Chaplin Oona O'Neill Christopher James Chaplin[1] (lahir 6 Juli 1962)[2] adalah seorang komposer dan aktor Inggris kelahiran Swiss.[3][4] Ia adalah putra bungsu dari pasangan komedian film Charlie Chaplin dan istri keempatny...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!