Anabolic steroids, also known as anabolic–androgenic steroids (AAS), are a class of drugs that are structurally related to testosterone, the main male...

The Lockheed Martin AN/AAS-38 Nite Hawk is a high-resolution FLIR, laser designator, and laser tracker pod system for use with laser-guided munitions...

The American Astronomical Society (AAS, sometimes spoken as "double-A-S"[citation needed]) is an American society of professional astronomers and other...

H. Monrad Aas (born 1948), Norwegian researcher Jan Aas (1944-2016), Norwegian footballer Jan Petter Aas, Norwegian handball player Jo Sondre Aas (born...

from the original on 2016-04-22. Retrieved 2015-02-15. Rubin, Tzameret H.; Aas, Tor Helge; Stead, Andrew (2015-07-01). "Knowledge flow in Technological...

Science. 6 (1): 101–116. doi:10.1080/21681376.2019.1578257. Rubin, Tzameret H.; Aas, Tor Helge; Stead, Andrew (July 2015). "Knowledge flow in Technological...

Abū al-ʿĀṣ ibn al-Rabīʿ (Arabic: أبو العاص بن الربيع, died in February, AD 634), was a son-in-law and companion of the Islamic prophet Muhammad. His original...

PMID 25051588. S2CID 15907952. Cooke, R.M.; Joe, H.; Aas, K. (January 2011). Kurowicka, D.; Joe, H. (eds.). Dependence Modeling Vine Copula Handbook...

spectroscopy (AAS) is an elemental analysis method for determining the concentration of metals in a given sample. The principle of AAS relies on the vaporization...

518666W. doi:10.1038/srep18666. PMC 4687041. PMID 26690504. Jeffrey, Wade H.; Aas, Peter; Lyons, M. Maille; Coffin, Richard B.; Pledger, Ralph J.; Mitchell...

Kätlin Aas (/ˈkeɪtlɪn/; Estonian pronunciation: [kætlin ɑːs], born 26 December 1992) is an Estonian fashion model. Aas was scouted at age fourteen while...

Finajet and Finaplix among others, is an androgen and anabolic steroid (AAS) medication used in veterinary medicine, specifically to increase the profitability...

androgens/anabolic steroids (AAS) and formulations that are approved by the FDATooltip Food and Drug Administration and available in the United States. AAS like testosterone...

of Aas (in French: langage sifflé d'Aas, occitan sifflé d'Aas; in Occitan: siular d'Aas) is a whistled language used in the Pyrennees village of Aas, located...

Inge Harald Monrad Aas (born October 21, 1948) is a Norwegian researcher. Born in Steinkjer, he was educated in odontology at the University of Oslo (1973)...

ʿAlī ibn Abī al-ʿĀṣ or ʿAlī ibn Zaynab bint Muḥammad was a companion and a grandson of the Islamic prophet Muhammad through his eldest daughter. Ali was...

Joseph H. Rothenberg (born c. 1941) is an American aerospace engineer and former NASA official. He is best known for leading the recovery of the Hubble...

XV: The Crisis of the Early Caliphate: The Reign of ʿUthmān, A.D. 644–656/A.H. 24–35. SUNY Series in Near Eastern Studies. Albany, New York: State University...

Muhammad Muhammad Al-Sayyid Hasanain Jibril (born 1964), commonly known as Sheikh Muhammad Jibril, is an Egyptian Qari (Quran reciter) and Islamic scholar...

Nils Sigurd Aas (21 April 1933 – 10 February 2004) was a Norwegian sculptor. He was one of the most prominent artists in modern Norwegian sculpture and...

Paul Dennis Aasness (December 16, 1939 – November 21, 2017) was an American farmer, businessman, and politician. Aasness lived on the family farm near...

peer-reviewed monthly scientific journal owned by the American Astronomical Society (AAS) and currently published by IOP Publishing. It is one of the premier journals...

Calcutta. Wensinck, A. J. (1960). "ʿAmr b. al-ʿĀṣ al-Sahmī". In Gibb, H. A. R.; Kramers, J. H.; Lévi-Provençal, E.; Schacht, J.; Lewis, B. & Pellat, Ch. (eds...

magnitude of Betelgeuse as a type II-P supernova". Research Notes of the AAS. 4 (3): 35. Bibcode:2020RNAAS...4...35G. doi:10.3847/2515-5172/ab7c68. S2CID 216398511...

Acute aortic syndromes (AAS) are a range of severe, painful, potentially life-threatening abnormalities of the aorta. These include aortic dissection...

and dihydrotestosterone (DHT) and synthetic anabolic–androgenic steroids (AAS) like nandrolone (19-nortestosterone). Many esters of testosterone have been...

Meri Main Tera Main Tera Tu Meri (2025) Anjaana Anjaani (2010) - "Aas Pas Khuda", "Aas Pas Khuda (Reprise)" (Along with Vishal Dadlani) Ra.One (2011) -...

steroid (AAS) that features an alkyl group, specifically a methyl or ethyl group, at the C17α position. Unlike many other AAS, 17α-alkylated AAS are orally...

their debut album. In November, the band released their debut album, Rakh Aas. The band's first video premiere was banned by Pakistan Television Corporation...

2024. Retrieved 24 July 2022. Hannaford, Peter. "Alan Walsh 1916–1998". AAS Biographical Memoirs. Australian Academy of Science. Archived from the original...

sufficient funds. In late 2012, the Army recommended that the AAS program proceed. The Army ended the AAS program in late 2013. In light of sequestration budget...

name Dianabol (D-Bol) among others, is an androgen and anabolic steroid (AAS) medication which is mostly no longer prescribed. It is also used non-medically...

The pharmacology of testosterone, an androgen and anabolic steroid (AAS) medication and naturally occurring steroid hormone, concerns its pharmacodynamics...

2024 recipient of the American Astronomical Society's (AAS) Education Prize, and was named an AAS Legacy Fellow in 2020. Liu was born in Taipei, Taiwan...

General Mission Analysis Tool (GMAT) (PDF). AAS Guidance and Control Conference. Hughes, Steven P.; Qureshi, Rizwan H.; Cooley, Steven D.; Parker, Joel J. (2014)...

synthetic, orally active, and extremely potent anabolic–androgenic steroid (AAS) and 17α-alkylated 19-nortestosterone (nandrolone) derivative which was never...

Bjarne Aas (28 February 1886 – 29 March 1969) was a Norwegian engineer, sailor, yacht designer and ship builder. Aas was born in Kristiania (now Oslo)...

Retrieved 12 August 2016. Joseph S. Tenn. "Henry L. Giclas (1910–2007)". AAS – American Astronomical Society. Archived from the original on 27 August...

This is a list of androgens/anabolic steroids (AAS) or testosterone derivatives. Androgen esters are mostly not included in this list. The major classes...

Academy of Sciences (AAS) is a non-aligned, non-political, not-for-profit, pan-African learned society formed in 1985. The AAS elects fellows (FAAS)...

(International Committee of Aerospace Activities) 1967: Space Flight Award (AAS) 1968: Outstanding Achievement Award (U.S. Treasury) 1969: National Space...

The American Antiquarian Society (AAS), located in Worcester, Massachusetts, is a learned society and a national research library of pre-twentieth-century...

Slightly Closer and a Tad Later than Previous Estimates". Research Notes of the AAS. 4 (12): 222. doi:10.3847/2515-5172/abd18d. Berski, Filip; Dybczyński, Piotr...

Fienberg, Richard Tresch (2006-09-12), New AAS Award for Backyard Research, Sky and Telescope, retrieved 2009-03-22 "AAS Announces 2016 Award Recipients". American...

sold under many brand names, is a synthetic androgen and anabolic steroid (AAS) medication derived from dihydrotestosterone (DHT). It is used to treat hereditary...

Astronomical Observatory (prior to 1 July 2010: Anglo-Australian Observatory) AAS – (organization) American Astronomical Society AAT – (telescope) Anglo-Australian...

Mitchel Air Force Base, New York, U.S. Education Farmingdale State College (AAS) SUNY Brockport (BA) Occupation Actor Years active 1987–present Spouses Betsy...

1993. 'Perfected Detroit', 1934 AAS winner 'Red Ace', hybrid, AGM, 2001. 'Rubidus', AGM, 2005. 'Ruby Queen', 1957 AAS winner 'Solo', AGM, 2005. 'Touchstone...

Sathi Ritviz & Nucleya Ari Ari Roz Baaraat 2022 Mimmi Aaj Na Ritviz Mehfooz Mimmi Chandamama Taj Jaana Ritviz & Karan Kanchan Pukaar Ritviz Aas Paas...

altitudes as H = 1 2 ( h a − 1 + h b − 1 + h c − 1 ) , {\displaystyle H={\tfrac {1}{2}}(h_{a}^{-1}+h_{b}^{-1}+h_{c}^{-1}),} we have T − 1 = 4 H ( H − h a − 1...

publications Archived 2012-02-29 at the Wayback Machine in BIBSYS Mikalsen, Espen H.; Aas Olsen, Trygve (25 November 2000). "NS-avkom i norske aviser". Dagbladet...

the brand name Proviron among others, is an androgen and anabolic steroid (AAS) medication which is used mainly in the treatment of low testosterone levels...

For the group stage, the 32 teams were drawn into eight groups (Groups A–H) of four containing a team from each of the four pots. The four losers of...

ΚΤΑ – Kappa Tau Alpha, 1948 (ACHS), journalism, mass communication honors AAS – Arnold Air Society, pre-1949, Air Force cadet honors ΠΔΦ – Pi Delta Phi...

promulgating the new rite for the consecration of a virgin, 31 May 1970, AAS 62 (1970) p. 650. It is a source of joy and hope to witness in our time a...

18-Methyltestosterone (18-MT) is an androgen/anabolic steroid (AAS) which was never marketed. Along with 19-nortestosterone (nandrolone) and 17α-ethynyltestosterone...

Mathematics Study Group system SAS is taken as one (#15) of 22 postulates. AAS (angle-angle-side): If two pairs of angles of two triangles are equal in...

Malaysian lawyers from the Malaysian Bar, Advocates' Association of Sarawak (AAS) and Sabah Law Association (SLA) lobbied the Malaysian government to intervene...

Raimo Aas (born 18 June 1953 in Tallinn) is an Estonian humorist. Raimo Aas performed together with Margus Lepa in the Sunday morning radio programme...

"New Horizons disk-integrated approach photometry of Pluto and Charon". AAS/Division for Planetary Sciences Meeting Abstracts. 47 (47). American Astronomical...

Rolon and Deca-Durabolin, among others, is an androgen and anabolic steroid (AAS) medication which is used primarily in the treatment of anemias and wasting...

Manual). TPub Integrated Publishing. p. II-G-1. Retrieved 15 June 2025. AAS-33A -Archived 11/98. Forecast International.com (Report). November 1997....

Pod with AN/ASG-34(V)1 IRST21 Martin Marietta AN/AAS-13 LANTIRN navigation pod Martin Marietta AN/AAS-14 LANTIRN targeting pod or Lockheed Martin AN/AAQ-33...

Taavi Aas (born 10 January 1966) is an Estonian politician who served as Minister of Economic Affairs and Infrastructure from 2019 to 2022. Aas was born...

the plate is a decal depicting the Rizal Monument. Standard format (B, E, H, J, L, MC, T, TR, etc.) –  white symbols on red-orange background  Public...

"Dilbar Mera" Shyam Ravindran Pankaj Awasthi Pankaj Awasthi 4:53 5. "Jo Maine Aas Lagayi" Pankaj Awasthi Pankaj Awasthi Pankaj Awasthi 2:05 6. "Anwar's Dream...

Metandren, and Testred among others, is an androgen and anabolic steroid (AAS) medication which is used in the treatment of low testosterone levels in...

Irradiances of a Habitable Zone "Wet" Sub-Neptune Planet". Research Notes of the AAS. 3 (12): 189. Bibcode:2019RNAAS...3..189G. doi:10.3847/2515-5172/ab6086....

by Tom Pickett, Keith Dallas, V.J. Delos-Reyes, Spencer Atkinson, and Tim Aas) in the Parthenon replica in Tennessee. The Hydra is ultimately defeated...

2011-03-10. Geni - Abdullah (Abu Hashim) bin Muhammad (b. - 776) Lammens, H. (1912). Fatima et les Filles de Mahomet (in French). Rome, Italy: Sumptibus...

doi:10.3390/ijerph14101265. PMC 5664766. PMID 29053641. Bø, S M; Bohne, R A; Aas, B; Hansen, L M (November 2020). "Material flow analysis for Norway's artificial...

March 2007. Quaas, Johannes; Jia, Hailing; Smith, Chris; Albright, Anna Lea; Aas, Wenche; Bellouin, Nicolas; Boucher, Olivier; Doutriaux-Boucher, Marie; Forster...

until AAS was cancelled. The AAS-72X had two external hardpoints and turret mounted visions system among other features, and was C-17 transportable AAS-72X+...

SSC-A09 Performance Maximum speed: 165 kn (190 mph, 306 km/h) Cruise speed: 151 kn (174 mph, 280 km/h) Range: 539 nmi (620 mi, 998 km) Service ceiling: 14,000 ft...

Trenbolone is an androgen and anabolic steroid (AAS) of the nandrolone group which itself was never marketed for human use. [clarification needed] Trenbolone...

prodrug) of an anabolic-androgenic steroid (AAS). They can be prohormones of testosterone or of synthetic AAS, for example, nandrolone (19-nortestosterone)...

U-2 Dragon Lady VH-92 Patriot X-55 ACCA X-56 X-59 Quesst Electronics AN/AAS-38 Nite Hawk Apache Arrowhead AN/APG-78 Longbow AN/APY-9 AN/FPS-117 AN/SPY-1...

Drostanolone, or dromostanolone, is an anabolic–androgenic steroid (AAS) of the dihydrotestosterone (DHT) group which was never marketed. An androgen...

PT5 Captured by Earth from September to November". Research Notes of the AAS. 8 (9): 224. doi:10.3847/2515-5172/ad781f. "West Antarctic Ice Sheet May...

Astronomy | American Astronomical Society". aas.org. Archived from the original on June 15, 2010. "W. H. Press received the 1981 Helen B. Warner Prize...

ISSN 0722-6691. "AAS Journals Will Switch to Open Access". American Astronomical Society (Press release). September 1, 2021. "AAS Journals Transition...

Target — Revising the Mass of Proxima Centauri c". Research Notes of the AAS. 4 (6): 86. Bibcode:2020RNAAS...4...86B. doi:10.3847/2515-5172/ab9ca9. S2CID 225798015...

Trenbolone enanthate is a synthetic and injected anabolic–androgenic steroid (AAS) and a derivative of nandrolone which was never marketed. It is the C17β...

The American Association of Suicidology (AAS) is a 501(c)(3) nonprofit organization which advocates for suicide prevention. It was established in 1968...

until AAS was cancelled. The AAS-72X had two external hardpoints and turret mounted visions system among other features, and was C-17 transportable AAS-72X+...

is a pilot and two sensor operators. The aircraft is equipped with the AN/AAS-52 Multi-spectral Targeting System, a color nose camera (generally used by...

University Press. ISBN 978-0-300-12808-6. Retrieved 29 April 2026. Tejasmara, Aas; et al. (2023). M., Rahmawati; et al. (eds.). Indonesian Population Report...

6". Praeparatio evangelica [Preparation for the Gospel]. Translated by E. H. Gifford. Retrieved 13 February 2025 – via Tertullian.org. Cease from these...

Connect. Momentum Media. Retrieved 8 May 2026. Cancian, Mark F.; Park, Chris H. (21 April 2026). "Last Rounds? Status of Key Munitions at the Iran War Ceasefire"...

methyltrienolone) is a synthetic and orally active anabolic–androgenic steroid (AAS) and a 17α-alkylated nandrolone (19-nortestosterone) derivative which was...

ISBN 978-82-8169-135-3. Schmidt, Nina; Skjevestad, Henrik (2020-05-25). "Vil ha Jon Wessel-Aas som ny leder av Advokatforeningen". www.advokatbladet.no (in Norwegian Bokmål)...

Libration Points with an Application to a Lunar Communications Problem". AAS Science and Technology Series: Space Flight Mechanics Specialist Symposium...

The Astrophysical Journal. 510 (1). The American Astronomical Society (AAS), The Institute of Physics (IOP): 232–250. arXiv:astro-ph/9512121. Bibcode:1999ApJ...

[astro-ph]. Grant, S. R.; Jones, G. H. (2025). "Prospects for the Crossing of Comet 3I/ATLAS's Ion Tail". Research Notes of the AAS. 9 (10): 276. arXiv:2510.13222...

speed: 362 kn (417 mph, 670 km/h) — Mach 0.59 at 22,000 ft (6,706 m) altitude Cruise speed: 348 kn (400 mph, 644 km/h) Range: 1,800 nmi (2,100 mi, 3,300 km)...

470 mph; 760 km/h) at 72,000 ft (22,000 m) Cruise speed: 413 kn (475 mph, 765 km/h) at 65,000 ft (20,000 m) Stall speed: 65 kn (75 mph, 120 km/h) Range: 6,090 nmi...

Eugene M., ed. (1982). Science Fiction and Space Futures: Past and Present. AAS History Series. Vol. 5. San Diego: Univelt. ISBN 0-87703-172-X. Frayling...

Retrieved 23 February 2023. "A New Stewardship Paradigm for Maunakea". aas.org. Retrieved 1 March 2023. "Frequently Asked Questions". Archived from...

"additional enemies" called in by bosses during encounters. Advance and secure (AAS) A player versus player team-based game mode used in tactical first-person...

George Zeno, Running Press (2012), ISBN 0-762445-10-6, 978-0-762445-10-3 Nils Aas: Marilyn Monroe (1992), Haugesund, Norway William Anastasi: Untitled (1995)...

Purvanchal Mahapanchayat 8,217 0.00 0 Janhit Sankalp Party 8,194 0.00 0 Aas Punjab Party 8,114 0.00 0 Dr. Ambedkar People's Party 8,089 0.00 0 Dhesiya...

Curve Model for an Accurate Galactocentric Distance". Research Notes of the AAS. 2 (3): 156. arXiv:1808.09435. Bibcode:2018RNAAS...2..156M. doi:10.3847/2515-5172/aadd4b...

Fiorelli, L.E.; Ezcurra, M.D.; Martinelli, A.G.; Ramezani, J.; Da Rosa, A.A.S.; Belén von Baczko, M.; Jimena Trotteyn, M.; Montefeltro, F.C.; Ezpeleta...

(AIAA), Battin was also a Fellow of the American Astronautical Society (AAS), a member of the National Academy of Engineering, and a member of the International...

חדשות. וואלה! (in Hebrew). 27 December 2018. Retrieved 12 January 2023. Aas, Uri (26 October 2003). גם השנה לא יתקיימו בחירות בכפר שחציו בלבנון. Haaretz...

The History of al-Ṭabarī, Volume X: The Conquest of Arabia, A.D. 632–633/A.H. 11. SUNY Series in Near Eastern Studies. Albany, New York: State University...

testosterone hydrocinnamate, is a synthetic anabolic-androgenic steroid (AAS) and an androgen ester – specifically, the C17β phenylpropionate ester of...

Anadrol and Anapolon among others, is an androgen and anabolic steroid (AAS) medication which is used primarily in the treatment of anemia. It is also...

“Which of the people is good in pronunciation?” They said: “Sa'id bin Al-Aas”. Uthman said: “Let Sa'id dictate and let Zayd write”. It is said that Uthman...

Anthropologica Sinica (in Chinese). 42 (6): 721–732. doi:10.16359/j.1000-3193/AAS.2023.0046. Binford, L.; Ho, C. K.; et al. (1985). "Taphonomy at a Distance:...

Wing UAC TurboTrain (1968) Sikorsky ASPB Assault Support Patrol Boat (1969) H-34 Choctaw Canadian CH-124 Sea King CH-54 Tarhe CH-53E Super Stallion MH-53J...

For the group stage, the 32 teams were drawn into eight groups (Groups A–H) of four containing a team from each of the four pots. The four losers of...

{{citation}}: ISBN / Date incompatibility (help) Olivelle 1992. Olivelle 1998. "AAS SAC A.K. Ramanujan Book Prize for Translation". Association of Asian Studies...

Smith, Graeme H. (10 June 2021). "The Distribution of Ground-based Reflecting Telescopes with Respect to Altitude". Research Notes of the AAS. 5 (6): 140...

named the Person of the Year by the American Association of Suicidology. The AAS stated, "The inaugural Person of the Year Award will be presented to Andrew...

S2CID 145805906. Braudel 1985, p. 143. Dunton 1896, p. 163. Brook 1998, p. 124. Aas 1976, pp. 410–11. Volker 1971, p. 22. Brook 1998, p. 206. Howard 1978, p...

film production Company was named as Filmyug meaning 'The Age Of Films'. Aas Ka Panchhi, released in 1960, was a Silver Jubilee hit and the company continued...

Wall Street Journal. Retrieved 25 July 2025. Cancian, Mark F.; Park, Chris H. (21 April 2026). "Last Rounds? Status of Key Munitions at the Iran War Ceasefire"...

Since their discovery, anabolic steroids (AAS) have been widely used as performance-enhancing drugs to improve performance in sports, to improve one's...

Carey, Jewel". leveland. Retrieved July 7, 2024. "Tim Robinson Biography". AAS. "Michigan native joins 'Saturday Night Live' cast in Saturday season-opener"...

Sciences of the American Astronomical Society (AAS), the Chambliss Astronomical Writing Award from the AAS and a NASA Honor Award for Exceptional Scientific...

ideas" linked to conspiracy theories. Lawyer and media law expert Jon Wessel-Aas [no] publicly stated that it is futile to demand the removal of a correct...

the PDCAAS percentage is: FTPD × AAS × 100%, where FTPD is fecal true digestibility and AAS is the amino acid score. AAS is calculated as mg of limiting...

anti-radiation missiles, the F-16CJ/DJ are equipped with a Lockheed Martin AN/AAS-35V Pave Penny laser spot tracker and the Texas Instruments AN/ASQ-213 HARM...

Tranensis, Substitutum Notarium Supremae S. Congregationis S. Officii;" AAS vol. 55 (1963), pp. 405, 904. Cunial was a native of Treviso, a priest of...

ARIZONA". jwst.nasa.gov. Retrieved 12 April 2019. "AAS Committee on the Status of Women". cswa.aas.org. Retrieved 2019-04-12. https://www.amphilsoc...

89–95. doi:10.1111/j.1399-302X.2008.00477.x. PMC 2742966. PMID 19239634. Aas JA, Griffen AL, Dardis SR, Lee AM, Olsen I, Dewhirst FE, Leys EJ, Paster...

of the asteroid, pronouncing the name: "DPS 52 Monday Press Conference". AAS Press Office. 26 October 2020 – via YouTube. Finlay, Alec; Sharples, Ray;...

William Muir - Google Books. Retrieved 2014-01-18. Martindale, J. R.; Jones, A. H. M. (1992). The Prosopography of the Later Roman Empire 2 Part Set: Volume...

(2017). "An Answer to Fermi's Paradox in the Prevalence of Ocean Worlds?". Aas/Division for Planetary Sciences Meeting Abstracts #49. 49. Bibcode:2017DPS...

until 2060. The F-15K has several atypical features to the F-15E, such as an AAS-42 infra-red search and track system, a customized Tactical Electronics Warfare...

film Bulundi, "Pyar Ka Dard Hai" from Dard and "Tum Jo Chale Gaye" from Aas Paas, a few days before his heart attack in 1981. He suffered his first heart...

Caliph Umar's governor of Bahrain, Usman ibn Abu al-Aas, who sent his brother Hakam ibn Abu al-Aas to raid and reconnoitre the Makran region around 636...

repository for the Chrony project". git.tuxfamily.org. Retrieved 31 July 2021. Aas, Josh. "More Memory Safety for Let's Encrypt: Deploying ntpd-rs". Let's Encrypt...

of Gliese 710 to the Solar System Using Gaia DR2". Research Notes of the AAS. 2 (2): 30. arXiv:1805.02644. Bibcode:2018RNAAS...2...30D. doi:10.3847/2515-5172/aac2d0...

in 906 unrelated African Americans (AAs) and 294 Barbadians (ACs) from a study of asthma. This analysis showed AAs on average were 72.5% African, 19.6%...

crime drama film Sikandar Ka Muqaddar, which released on Netflix. Harsh B.H. from Film Companion said that since his debut Tiwary has teetered between...

2020-08-24. "George Rieke". www.nasonline.org. Retrieved 2020-08-24. "AAS Fellows". AAS. Retrieved 30 September 2020. Detection of Light: from the Ultraviolet...

Martin Aas (July 7, 1931 – April 3, 2000) was a Norwegian actor, director, and screenwriter that worked in theater, film, and TV. From 1970 to 1973, Aas was...

U-2 Dragon Lady VH-92 Patriot X-55 ACCA X-56 X-59 Quesst Electronics AN/AAS-38 Nite Hawk Apache Arrowhead AN/APG-78 Longbow AN/APY-9 AN/FPS-117 AN/SPY-1...

PMC 7581287. PMID 32927946. Chen, Gang; Canonaco, Francesco; Tobler, Anna; Aas, Wenche; Alastuey, Andres; Allan, James; Atabakhsh, Samira; Aurela, Minna;...

Times to Trans-Neptunian Objects. 2024 AAS/AIAA Astrodynamics Specialist Conference. Denver, Colorado. p. AAS 24-472. Retrieved October 19, 2025. Anderson...

search.amphilsoc.org. Retrieved 2021-12-03. "Zewail Ahmed Hassan | The AAS". www.aasciences.africa. Archived from the original on 2022-12-15. Retrieved...

72.7 lb/sq ft (355 kg/m2) Power/mass: 0.19 hp/lb (0.31 kW/kg) Avionics AN/AAS-36 FLIR AN/ACQ-5 TADIL-A/Link 11 modem AN/ALR-73 Passive Detection System...

an American Tradition. John Wiley & Sons. p. 542. ISBN 978-1-4443-9379-8. AAS 45 (1953) Archived 2019-08-12 at the Wayback Machine, pp. 677–678. "ce qu'une...

Butt SAB TV 2024 Pagal Khana Natha Green Entertainment Baby Baji Qureshi Sahab ARY Digital 2025 Aas Paas Ausaf Geo Entertainment Mafaad Parast Muneer...

convince his colleagues". Smithsonian. Washington DC: Smithsonian Institution. "AAS Fellows". American Astronautical Society. Retrieved February 22, 2023. "Fellows"...

Monrad (1811–1887), Danish politician and bishop of Lolland-Falster I. H. Monrad Aas (born 1948), Norwegian researcher Jens Zetlitz Monrad Kielland (1866–1926)...

Retrieved 28 August 2021. SASAC. "Timeline". Hindutva Harassment Field Manual. "AAS Statement on the Dismantling Global Hindutva Conference". Association for...

American Astronautics (Aas History Series; V. 3). Univelt. ISBN 978-0877031499. Wikimedia Commons has media related to John H. Disher. Wikiquote has quotations...

for Science Advancement. 11 March 2019. Retrieved 7 February 2020. "AAS Fellows". AAS. Retrieved 30 September 2020. "Keivan G. Stassun". www.macfound.org...

Brightness Model for the Starlink "Visorsat" Spacecraft". Research Notes of the AAS. 4 (10): 182. arXiv:2107.06026. Bibcode:2020RNAAS...4..182C. doi:10.3847/2515-5172/abc0e9...

Lily, dancer Phir Wohi Raat Shobha Hum Paanch Nishi Jwalamukhi 1981 Kaaran Aas Paas Commander Rocky Jyoti Love Story Thee (Tamil film) Item dancer Yaarana...

Centre for International Environment and Development Studies. Noragric. Aas. Retrieved 19 May 2008. "Vol 12 (2004): Camas Daraich: a Mesolithic site...

mayor of Tallinn, Estonia from April 2019, after the resignation of Taavi Aas, until the passing of a non-confidence motion on 26 March 2024. Kõlvart was...

for competing in the Thailand Super Series, and is also the executive of AAS Group. Inthraphuvasak lived in Bangkok until the age of 14, attending an...

speed: Mach 1.6 at high altitude (1,228 mph / 1,976 km/h) Mach 1.06, 700 knots (806 mph; 1,296 km/h) at sea level Range: 1,500 nmi (1,700 mi, 2,800 km) Combat...

Arjuna 2025 PN7, the Newest Quasi-satellite of Earth". Research Notes of the AAS. 9 (9): 235. Bibcode:2025RNAAS...9..235D. doi:10.3847/2515-5172/ae028f. Minor...

Retrieved 8 September 2013. Threadgold, Ian M.; Zembeck-England, Kristin; Aas, Per Gunnar; Fontana, Philip M.; Hite, Damian; Boone, William E. (2006)....

U-2 Dragon Lady VH-92 Patriot X-55 ACCA X-56 X-59 Quesst Electronics AN/AAS-38 Nite Hawk Apache Arrowhead AN/APG-78 Longbow AN/APY-9 AN/FPS-117 AN/SPY-1...

Badmaash Billa Jaani Dushman Thakur 1980 Bombay 405 Miles Inspector Ram 1981 Aas Paas Master Ek Duuje Ke Liye Danny Kaalia Public Prosecutor 1982 Khuddaar...

4-chloro-17β-hydroxy17α-methylandrosta-1,4-dien-3-one, is an anabolic–androgenic steroid (AAS). It is the 4-chloro-substituted derivative of metandienone (dehydromethyltestosterone)...

Firefox 4". mozilla.dev.planning on Google Groups. Retrieved July 14, 2012. Aas, Josh (November 10, 2010). "Firefox 4 for Mac OS X: Under the Hood". Boom...

Heineman Prize for Astrophysics". UChicago News. Retrieved 8 July 2017. "AAS Fellows". AAS. Retrieved 27 September 2020. "Nature's 10: the people who helped...

Archived from the original on 1 October 2018. Retrieved 23 January 2014. Aas, Odd Inge; Staveli, Marius (22 March 2014). "Magnus Carlsen sjokkerte med...

Pos Team Pld W D L GF GA GD Pts Qualification AAS CAM ALI UCV 1 Alianza Atlético 3 3 0 0 5 1 +4 9 Round of 16 2–0 2 Carlos A. Mannucci 3 2 0 1 6 4 +2...

MMP MMP MER AAS 43rd 34 2018 Sunrise Ford Racing 22 Ford KCR 6 TUS 11 TUS 5 OSS 6 CNS 3 SON 20 DCS 8 IOW 9 EVG 10 GTW 7 LVS 7 MER 6 AAS 11 KCR 3 6th...

Pheraplex, is a synthetic and orally active anabolic–androgenic steroid (AAS) and a 17α-methylated derivative of dihydrotestosterone (DHT) which was never...

Meeting Abstracts. American Astronomical Society. Bibcode:2017DPS....4921902B. AAS-219.02. Hörst, Sarah (22 July 2015). "What in the world(s) are tholins?"...

to 1996, Shu was also the President of the American Astronomical Society (AAS). Shu was named a University Professor of the University of California (UC)...

Notes 1958 Harry Black Nurse Somola 1960 Tales of the Vikings Dara 1961 Aas Ka Panchhi 1962 Geronimo Teela with Chuck Connors 1964 The Rogues Glana Lupescu...

Chandi Punjabi / Bengali Baghi Urdu Darbar-e-Habib Urdu Haqeeqat Urdu 1957 Aas Paas Urdu Anjaam Urdu Murad Urdu Masoom Urdu 1958 Tamanna Urdu Jan-e-Bahar...

projects, including his father's production Aap Ke Deewane (1980). In Prakash's Aas Paas (1981), he appeared in the song "Shehar Main Charcha Hai". The actor's...

Rights Watch. pp. 37–38. Retrieved 29 September 2023. Cordesman, Anthony H.; Lin, Aaron (7 July 2015). The Changing Military Balance in the Koreas and...

Observations of Potentially Hazardous Asteroid 2024 YR4". Research Notes of the AAS. 9 (4) 70. Bibcode:2025RNAAS...9...70R. doi:10.3847/2515-5172/adc6f0. Pravec...

in aviation, avionics, aerospace, and aeronautics. Contents A B C D E F G H I J K L M N O P Q R S T U V W X Y Z See also References External links List...

Kohler, Susanna (25 April 2016). "Can CMB experiments find Planet Nine?". AAS Nova. American Astronomical Society. Archived from the original on 31 May...

AN/ANQ-139 forward-looking radar, a low-light television system, and an AN/AAS-26 forward-looking infrared detector. A laser rangefinder/designator was...

Year Team No. Make 1 2 3 4 5 6 7 8 9 10 11 12 AMSWC Pts Ref 2023 Rette Jones Racing 30 Ford PHO 6 IRW KCR PIR SON IRW SHA EVG AAS LVS MAD PHO 41st 38...

heavier cornering. Another new feature was the Auto Adjusting Suspension (AAS). The system changed damping characteristics according to the road and driving...

Hobart was elected a member of the American Antiquarian Society in 1814. The AAS holds numerous books and pamphlets authored by or related to Hobart, including...

Color, and Luminosity of the Milky Way". American Astronomical Society, AAS Meeting #221, #254.11. 221: 254.11. Bibcode:2013AAS...22125411L. "The Interstellar...

Slightly closer and a tad later than previous estimates". Research Notes of the AAS. 4 (12): 222. Bibcode:2020RNAAS...4..222D. doi:10.3847/2515-5172/abd18d....

which had fallen back into the hands of the Byzantines soon after Amr ibn al-Aas' departure. Then Ghadames, and a place referred to as "Elenptien" by the...

Latin to Proto-Romance is provided below. Their precise order is uncertain. /h/ is lost without a trace in all positions. If that results in a collision...

Team No. Make 1 2 3 4 5 6 7 8 9 10 11 12 AMSWC Pts Ref 2025 Pinnacle Racing Group 28 Chevy KER PHO 2* TUC CNS KER SON TRI PIR AAS MAD LVS PHO 41st 44...

Assign Alternate Parent AAR – After Action Report AAR – After Action Review AAS – Army Apprentice School (Australia) AAST – Aeromedical Evacuation Administrative...

Stellenbosch University". "AAS Fellow Prof Deresh Ramjugernath appointed as SU's new Deputy Vice-Chancellor: Learning and Teaching | The AAS". www.aasciences.africa...

"Hairat,"I Feel Good", "Tujhe Bhula Diya" (Along with Kumar), "Aas Pas Khuda" & "Aas Pas Khuda (Reprise)" (Along with Shekhar) (2010) Tees Maar Khan...

Malik Hasrat Jaipuri solo 1627 "Rang Ude Rangon Mein" Anjaan Asha Bhosle Aas Paas 1628 "Tum Jo Chale Gaye" Laxmikant-Pyarelal Anand Bakshi Lata Mangeshkar...

by the American Astronomical Society's Division for Planetary Sciences (AAS/DPS) for outstanding communication by an active planetary scientist to the...

and Bernie Sanders of Vermont caucus with the Democratic Party. A C D F G H I K L M N O P R S T U V W Seniority in the United States Senate List of current...

Kapoor, Saira Banu 3. Gharana Rajendra Kumar, Raaj Kumar, Asha Parekh 4. Aas Ka Panchhi Rajendra Kumar, Vyjayanthimala 5. Jab Pyar Kisi Se Hota Hai Dev...

(May 12, 2022). "First Image of the Milky Way's Supermassive Black Hole". AAS Nova. Archived from the original on August 2, 2022. Retrieved May 13, 2022...

sensors include: AAR-47 Missile Approach Warning System by ATK, Raytheon AAS-44 electro-optical system that integrates FLIR and laser rangefinder, ALE-39...

Alexandria; Allabn Al-Hazermi to Munzer bin Sawa the king of Bahrain; Amer bin Aas to the king of Oman. Salit bin Amri to Hozah bin Ali— the king of Yamama;...

certified registered nurse anesthetists (CRNAs) and anesthesiologist assistants (AAs). In other countries – such as United Kingdom, Australia, New Zealand, and...

Kaisi Hai Ye Ruswai Tania Express Entertainment 2025 Sitaron Se Aagay Aina Aas Paas Arshia Geo Entertainment Ramadan Series Humraaz Mishal Mohra Alizey...

Archived from the original on August 16, 2019. Retrieved August 16, 2019. "AAS in Technical Studies – College of Applied Studies and Academic Success –...

code name RU-18761), is a naturally occurring anabolic–androgenic steroid (AAS) and the 1(2)-dehydrogenated analogue of testosterone. Boldenone itself has...

Hans Aas (22 September 1880 – 5 August 1960) was a Norwegian trade unionist. Aas was born in Tromsø. He joined his first trade union in 1906, and chaired...

delayed fuze capability Weight: 106 lb (48 kg) Speed: Mach 1.3 (1,600 km/h) Diameter: 7.1 in (180 mm) Wingspan: 13 in (0.33 m) Length: 5 ft 4 in (1.63 m)...

Ultimately the company was not downselected for the JMR effort, and the AAS program was cancelled. Eurocopter saw the offshore oil market and Search...

"Dr. Catherine Adams". Roundway Centre. Retrieved 2023-09-03.[dead link] AAS, Donnesa McPherson (April 5, 2022). "Symbols for Autism: What Do They Mean...

Zolan; Aleaziz, Hamed; Sun, Albert; Bosman, Julie (March 7, 2026). "How D.H.S. Retreated on Immigration Tactics After Minneapolis". The New York Times...

Astrophysics Prize Goes to Michael McCarthy | American Astronomical Society". aas.org. Retrieved 2026-04-23. "McCarthy Group". lweb.cfa.harvard.edu. Retrieved...

Film Language 1968 Ashiq Urdu 1969 Salgira Urdu 1972 Hill Station Urdu 1973 Aas Urdu 1974 Shama Urdu 1976 Aap Ka Khadim Urdu 1976 Shabana Urdu 1976 Society...

Long Island, New York, U.S. Education Suffolk County Community College (AAS) Occupations Television Meteorologist Realtor Height 5 ft 6 in (1.68 m) Children...

weapon and sensor payloads to meet combat requirements. Its Raytheon AN/AAS-52[citation needed] multi-spectral targeting sensor suite includes a color/monochrome...

Pos Driver KER PHO TUC SHA CNS TRI SON PIR AAS MAD LVS PHO KER Points 1 Trevor Huddleston 4 4 2 1* 1* 2 9 13 379 2 Mason Massey 1 5 12 3 4 5 19 1 361...

(1980) Ek Aur Ek Gyarah (1981) Shakka (1981) Naseeb (1981) Kranti (1981) Aas Paas (1981) Sansani: The Sensation (1981) Sawaal (1982) Desh Premee (1982)...

of Saint Javelin". European Security & Defence. Mittler Report Verlag GmbH. Retrieved 20 March 2023. "Javelin". Redstone.army.mil. Archived from the...

PMC 8728638. PMID 17253496. Smedslund G, Dalsbø TK, Steiro AK, Winsvold A, Clench-Aas J (July 2007). Smedslund G (ed.). "Cognitive behavioural therapy for men...

Bhare Bazaar Karenge Unse Ankhen Char" Naag Lok - "Yeh Kaisi Bijli Giri" "Aas Liye Aakhir Kailasi" "Shankar Bhole Bhaale" with Mohammed Rafi Naag Mani...

Love Me" "Mohabbat Hai Mirchi" "Mohabbat Hai Mirchi (Spicy Mix)" Dhund "Aas Paas" Viju Shah Fun2shh... Dudes in the 10th Century "Hold" Pritam KK, Sunidhi...

Retrieved 2024-11-04. Vesteng, Camilla; Folvik, Herman; Skålevik (foto), Gabriel Aas (2025-06-21). "Helene Spilling og Martin Ødegaard feiret ekteskapet i Gjerdrum"...

(2) Odd Tolvsrød 14:00 CEST (UTC+2) Srour 24' Bruun 76' Ramstad 84' Report Aas 56' Harðarson 89' Stadium: Flint Esso Arena Attendance: 200 Referee: Pavel...

Aladdin Assault Squad: In the Malibu Ultraverse, the Aladdin Assault Squad/A.A.S. was a special department within the government agency known as Aladdin...

amino acyl residues (aas)): TC# 1.E.10 - 138 ± 6 aas TC# 1.E.16 - 149 ± 15 aas TC# 1.E.19 - 141 ± 12 aas TC# 1.E.40 - 173 ± 149 aas Thus, there is very...

Supplement Series. 124 (1): 75–84. Bibcode:1997A&AS..124...75T. doi:10.1051/aas:1997181. ISSN 0365-0138. Harvin, James A.; Gies, Douglas R.; Bagnuolo, William...

Alexandria; Allabn Al-Hazermi to Munzer bin Sawa the king of Bahrain; Amer bin Aas to the king of Oman. Salit bin Amri to Hozah bin Ali— the king of Yamama;...

the Gaia-unWISE Quasar Catalog: An All-Sky Spectroscopic Quasar Sample". AAS Journals. 964 (1): 69. arXiv:2306.17749. Bibcode:2024ApJ...964...69S. doi:10...

S2CID 259262475. Astrobites (24 June 2020). "Transiting Brown Dwarfs from TESS 2". AAS Nova. Retrieved 2013-03-16. Allard, France; Homeier, Derek (2007). "Brown...

Gunvald Aus, also written Aas (May 30, 1851 – May 27, 1950) was a Norwegian-American engineer. He is most associated with the engineering of the Woolworth...

Sciences Award (2000) IAASS Jerome Lederer Space Safety Pioneer Award (2008) AAS Dirk Brouwer Award (2010) Scientific career Fields Senior Scientist for Orbital...

All times are local (Central European Summer Time; UTC+2). Source: IIHF (H) Host Source: IIHF Winning teams in the quarterfinals will be reseeded according...

Triaud, Amaury H. M. J.; Hales, Antonio S. (December 2025). "Non-detection of J1407 b in ALMA Band 7 Observations". Research Notes of the AAS. 9 (12): 326...

"The Distance to the Pleiades According to Gaia DR2". Research Notes of the AAS. 2 (3): 150. Bibcode:2018RNAAS...2..150A. doi:10.3847/2515-5172/aada8b. hdl:11336/94435...

(December 22, 2014). "Have A Sirius-ly Scintillating Holiday!". Sky & Telescope. AAS Sky Publishing LLC. Espenak, Fred. "Mars Ephemeris". Twelve Year Planetary...

Hornet engine. Since 1993, the AAS-38A NITE Hawk added a designator/ranger laser, allowing it to self-mark targets. The later AAS-38B added the ability to strike...

Kalpana Chairman of Bharti kala kendra Apna Haath Jagannath Vrindavan 1961 Aas Ka Panchhi Army officer Reshmi Rumal Ram Narayan Maya Dance announcer Bada...

U-2 Dragon Lady VH-92 Patriot X-55 ACCA X-56 X-59 Quesst Electronics AN/AAS-38 Nite Hawk Apache Arrowhead AN/APG-78 Longbow AN/APY-9 AN/FPS-117 AN/SPY-1...

review". Acta Anaesthesiologica Scandinavica. 59 (6): 685–697. doi:10.1111/aas.12489. PMID 25903457. S2CID 20134091. Lohnberg JA, Altmaier EM (June 2013)...

Retrieved 12 January 2022. "Explaining the Birth of the Martian Moons". AAS Nova. American Astronomical Society. 23 September 2016. Archived from the...

testing in late October 2025. It is expected to cruise at Mach 1.42 (1,510 km/h; 937 mph) at an altitude of 55,000 ft (16,800 m). It is designed to create...

was the mutation of Latin initial f into h- whenever it was followed by a vowel that did not diphthongize. The h-, still preserved in spelling, is now silent...

Shia sources, are: Zaynab (599–629). She married her maternal cousin Abu al-Aas ibn al-Rabee before al-Hijra. Later lived with Muhammad. Her husband accepted...

degrees: Batsheva graduated from the Fashion Institute of Technology with an AAS in Accessories Design; [citation needed] Shlomo studied at the Honors Program...

University of Florida known for establishing synthetic biology and paleogenetics, aas wll as contributing to understanding of the origin of life; Paul Berg FRS...

times are local (Central Daylight Time; UTC-5). Source: IIHF Source: IIHF (H) Host Winning teams in the quarterfinals will be reseeded according to their...

L.; Baines, K. H. (2015). Chemistry in the Venus clouds: Sulfuric acid reactions and freezing behavior of aqueous liquid droplets. AAS/Division for Planetary...

Chauhan". 6 September 2018. Retrieved 27 April 2022 – via YouTube. "Mere Aas Paas, full song starring Sonal Chauhan". 18 April 2019. Retrieved 27 April...

"N.H.L.; Golisano Group To Buy Sabres (Published 2003)". The New York Times. ISSN 0362-4331. Retrieved 2021-02-03. Blair, Jayson (2003-03-14). "N.H.L.;...

Height (max. elevation): not available Maximum road speed: 40 mph (64 km/h) Cruise range: 300 miles (480 km) Reload time: 4 minutes (M270) 3 minutes...

(aged 24) Le Mans 13 3MF Ruth Bulala (2004-04-08)8 April 2004 (aged 21) AAS Sarcelles 14 4FW Anastasia Soulac (2003-11-25)25 November 2003 (aged 21)...

227–232. doi:10.2478/frp-2013-0022. Tischler, W. H. (1976). "Untersuchungen über die tierische Besiedlung von Aas in verschiedenen Strata von Waldökosystemen"...

capitalizations. Contents A B C D E F G H I K L M N O P Q R S T U V W X Z See also References A – adele ring or algebraic numbers. a.a.s. – asymptotically almost surely...

Sawan Badli 1961 Chhote Nawab Roshan 1961 Pyase Panchhi 1961 Piya Milan Ki Aas 1961 Pyaar Ki Dastan 1961 Ek Ladki Saat Ladke 1961 Main Aur Mera Bhai 1961...

supreme. Internet Archive. Christchurch, N.Z. : AAS Publications. ISBN 978-0-473-05700-8. Johnson, Martin H. (1 June 2019). "IVF: The women who helped make...

inducted to the Mumbai film industry. In J. Om Prakash's first production, Aas Ka Panchhi (1961) starring Rajendra Kumar, Subir Sen sang the title song...

Lashevich and Belenky, whom the party has known for more than two decades aas devoted and disciplined members," this so-called "Declaration of the Thirteen"...

She was awarded first Sarla Birla Award for her contribution to theatre, AAS Excellence Award 2016 for her participation in women empowerment initiatives...

target: Revising the mass of Proxima Centauri c". Research Notes of the AAS. 4 (6): 86. Bibcode:2020RNAAS...4...86B. doi:10.3847/2515-5172/ab9ca9. S2CID 225798015...

1073/pnas.1704213114. PMC 5703273. PMID 29109261. Low, R.K.Y.; Faff, R.; Aas, K. (2016). "Enhancing mean–variance portfolio selection by modeling distributional...

was for the movie Aas Paas, with music by Laxmikant-Pyarelal. One source says it was "Shaam Phir Kyun Udaas Hai Dost/Tu Kahin Aas Paas Hai Dost", recorded...

Curve Model for an Accurate Galactocentric Distance". Research Notes of the AAS. 2 (3): 156. arXiv:1808.09435. Bibcode:2018RNAAS...2..156M. doi:10.3847/2515-5172/aadd4b...

5–3 Dylan Quinn Anca Zijlstra 4–2 Paula Jacklin March 21–22 AB Open Bronze AAS Hull-Volant Gatineau C$2,200 Jean-Michel Legault 5–4 Shane Sakchekapo Kayla...

Machine, section 2.6.4 Linux 6.3 kernel sources, /arch/x86/include/asm/cpuid.h Archived 2023-04-27 at the Wayback Machine, line 69 gcc-patches mailing list...

AMP 3 1st 2013 2008 AAS 3 CTS 7 SON 9 DCS 17 EVG 11 MMP 2 4th 1919 Toyota PHO 1 IOW 4 CNS 2 IRW 11 IRW 14 AMP 17 AAS 2 2009 CTS 7 AAS 7 PHO 4 MAD 3 IOW...

1039/RR9710400129. Campbell, John. (1999) Rutherford: Scientist Supreme, AAS Publications, Christchurch, ISBN 0-4730-5700-X Marsden, E. (1954). "The Rutherford...

Defense Technology and Xi'an Satellite Control Center" (PDF). Proceedings of AAS/AIAA Astrodynamics Specialist Conference. Liu, Cixin. The Dark Forest. Head...

Superdrol, is a synthetic and orally active anabolic–androgenic steroid (AAS) which was never marketed for medical use. It was sold legally for 9 years...

name Thiodrol, is an injected antiestrogen and anabolic–androgenic steroid (AAS) of the dihydrotestosterone (DHT) group which was described in the literature...

all-around champion in 1987 and 1988. Kerr was named the Southeastern Conference H. Boyd McWhorter Scholar-Athlete of the Year in 1990, one of only four Florida...

U-2 Dragon Lady VH-92 Patriot X-55 ACCA X-56 X-59 Quesst Electronics AN/AAS-38 Nite Hawk Apache Arrowhead AN/APG-78 Longbow AN/APY-9 AN/FPS-117 AN/SPY-1...

U-2 Dragon Lady VH-92 Patriot X-55 ACCA X-56 X-59 Quesst Electronics AN/AAS-38 Nite Hawk Apache Arrowhead AN/APG-78 Longbow AN/APY-9 AN/FPS-117 AN/SPY-1...

Contents A B C D E F G H I J K L M N O P Q R S T U V W X Y Z This list contains acronyms and initials related to diseases (infectious or non-infectious)...

should only be attempted by individuals with well-developed super-egos. Most AAs were strongly opposed to his experimenting with a mind-altering substance...

Lie DF Macken Widerøe Aas DF Einar Friis Baastad MF H. Fredrik Holmsen MF Harald Johansen MF Carl Frølich Hanssen FW Rolf Aas FW Sigurd Brekke FW Hans...

1097/MD.0000000000036549. PMC 10727629. PMID 38115348. Vold JH, Gjestad R, Aas CF, Chalabianloo F, Skurtveit S, Løberg EM, Johansson KA, Fadnes LT (2020)...

Supplement Series. 124: 75–84. Bibcode:1997A&AS..124...75T. doi:10.1051/aas:1997181. Wilson, Ralph Elmer (1953). "General catalogue of stellar radial...

2023. Spence, Ewan (18 November 2004). "Cory Doctorow (the EFF) Interview". AAS: All About Symbian. Archived from the original on 20 June 2023. Retrieved...

Astronomy of the American Astronomical Society (AAS) (1972) Henry Norris Russell Lectureship of the AAS (1980) INSA-Vainu Bappu Memorial Award (1993) Membership...

supporter group of the Australian national team is Australian Active Support (AAS). AAS, then known as Socceroos Active Support (SAS), was founded in January...

Thermo 90DW heater, axial compressor, UNZ-50 inertial navigation with GPS, AAS-1 Taifos radiation detection, SSC-1A Obra laser warning, a new NBC and filtration...

McAnally Racing 19 Toyota AAS 15 2023 Venturini Motorsports 15 Toyota PHO 16 IRW 1 KCR 1 PIR 11 SON 6 IRW 12 SHA 1 EVG 1* AAS 2 LVS 16* MAD 5 PHO 3 1st...

Religion and Conscience, 23–25 October 2003 ISSN 1645-6564 AAS, 1942, 313 AAS 1946 246. AAS 148, 171 AAS 1951, 780 Mark Miravalle, 1993, Introduction to Mary...

Calvin Vaz to tweak those sounds. Rahat Fateh Ali Khan, was chosen to record "Aas Paas Khuda" as they wanted "a voice that could make the high-notes pierce...

the ones he had in Babylonia. His name was rendered as Eyan in Hurrian, Aaš in Hittite, and Iyas in Luwian. He could be invoked as a divine witness in...

5α-androst-1-en-3β-ol-17-one) is a synthetic, orally active anabolic-androgenic steroid (AAS). It is an androgen prohormone of 1-testosterone (dihydroboldenone), 1-androstenedione...

Performance Maximum speed: 602 km/h (374 mph, 325 kn) Cruise speed: 583 km/h (362 mph, 315 kn) Minimum control speed: 194 km/h (121 mph, 105 kn) Range: 1,759 km...

Jan; Shao, Min; Wang, Yanhui; Shang, He; Zhang, Xiaoshan; Solberg, Svein; Aas, Wenche; Økland, Tonje; Eilertsen, Odd; Angell, Valter; Liu, Quanru; Zhao...

HCG is included in some sports' banned substances lists. When exogenous AAS (Anabolic Androgenic Steroids) are put into the male body, natural negative-feedback...

← pre-Gmc *wúlpōom ← PIE **wĺ̥kʷoHom; ō-stem gen.pl. **-ôz ← pre-Gmc **-āas ← PIE **-eh₂es. contraction of short vowels: a-stem nom.pl. *wulfôz 'wolves'...

587  Norway (equalled) Ståle Waagbø 2000 587  Norway (equalled) Ole-Harald Aas 2022 Baku 587  Finland (equalled) Jari Koivu 5 January 2002 Kuortane 585...

m s−1: A Jupiter-mass Planet Signature in ε Eri", Research Notes of the AAS, 5 (6): 155, arXiv:2107.01090, Bibcode:2021RNAAS...5..155M, doi:10.3847/2515-5172/ac0f59...

Names of both Zainab and Abu Al-'Aas highlighted in red. From the hadith manuscript MS. Leiden Or. 298, dated 866 CE....

doi:10.1097/YCO.0000000000000419. PMID 29537983. Pruessner M, Cullen AE, Aas M, Walker EF (February 2017). "The neural diathesis-stress model of schizophrenia...

from the C-130H and went into service in the 1990s. Four of the original 24 H-series aircraft have been lost in operations. The Combat Shadows were built...

10 March 2017. Retrieved 11 November 2016. Rutz, C.; Bluff, L.A.; Weir, A.A.S.; Kacelnik, A. (4 October 2007). "Video cameras on wild birds". Science...

Curve Model for an Accurate Galactocentric Distance". Research Notes of the AAS. 2 (3): 156. arXiv:1808.09435. Bibcode:2018RNAAS...2..156M. doi:10.3847/2515-5172/aadd4b...

Retrieved 25 April 2020. "Celebration in America". Mid-Autumn Festival (AAS 220). Stonybrook. Retrieved 25 April 2020. "Annual August Moon Festival:...

the Gorky Automobile Plant in Russia initially producing Ford Model A and AAs, thereby playing an important role in the industrialization of that country...

Consecrated Life". 2 February 2017. AAS, 1956, p. 354 ff AAS, 1956, p. 357 AAS, 1950, p. 657 AAS 1954 p. 313 AAS 1957, p. 272 Humani generis (1950) and...

January meeting of the American Astronomical Society (AAS), placing it de facto among the annual AAS prizes. Submissions and nominations are overseen by...

U-2 Dragon Lady VH-92 Patriot X-55 ACCA X-56 X-59 Quesst Electronics AN/AAS-38 Nite Hawk Apache Arrowhead AN/APG-78 Longbow AN/APY-9 AN/FPS-117 AN/SPY-1...

Retrieved November 28, 2025. Bodie, 2001, p. 51. Current Biography Yearbook. H. W. Wilson Co. 1969. p. 199. At that time, Lockheed did not as yet have a...

black hole, Daily Telegraph, 1997-06-27. Retrieved 2008-01-24 Allan, John H. (May 14, 1974). "Franklin National Bank Dismisses Its President". The New...

of the film was an overnight success with songs like Tujhe Bhula Diya and Aas Paas Hai Khuda becoming all-time chartbusters. Housefull 2 was released on...

navigation accuracy. Beginning in 1979, all A-6Es were fitted with the AN/AAS-33 DRS (Detecting and Ranging Set), part of the 'Target Recognition and Attack...

Retrieved 3 May 2025. Clayton, Govinda; Nygård, Håvard Mokleiv; Rustad, Siri Aas; Strand, Håvard (2023). "Ceasefires in Civil Conflict: A Research Agenda"...

time of 29.406 seconds and a speed of 183.636 miles per hour (295.533 km/h). Though he started on the pole, he lost the lead to Carl Edwards early. However...

earl", i.e. prince or similar. Notable people named Erling include: Erling Aas-Eng (born 1965), Norwegian politician Erling Aastad (1898–1963), Norwegian...

Montsec Observatory (Observatori Astronòmic del Montsec; OAdM) CT Observatori AAS Montsec K04 Lo Fossil Observatory CT Lo Fossil Observatory, Àger K05 Eden...

Astronomer at Goettingen, Hamburg, Mount Wilson, and Palomar Observatories". AAS/Division of Dynamical Astronomy Meeting #33. 33. Harvard Univ: 10.03. Bibcode:2002DDA...

precession, nutation, and perturbations due to figure and planetary terms". AAS Division on Dynamical Astronomy. 36 (2): 67. Bibcode:2004DDA....35.0805C...

"Breakthrough Listen Search for the WOW! Signal*". Research Notes of the AAS. 6 (9): 197. Bibcode:2022RNAAS...6..197P. doi:10.3847/2515-5172/ac9408. ISSN 2515-5172...

doi:10.1007/s00439-016-1749-4. ISSN 1432-1203. PMC 5214768. PMID 27896429. Aasly JO (May 2020). "Long-Term Outcomes of Genetic Parkinson's Disease". Journal...

John Mitzewich Born John Armand Mitzewich Education AAS Culinary Arts/Chef Training Years active 2007–present Spouse Michele Manfredi Culinary career...

Archived from the original (PDF) on 9 February 2006. "Askøy Bridge" (PDF). Aas-Jakobsen. Archived from the original (PDF) on 3 September 2011. Retrieved...

Public Viewing Event for the October 14, 2023 Solar Eclipse". Bulletin of the AAS. 56 (3). Bibcode:2024BAAS...56c.017D. doi:10.3847/25c2cfeb.08579f39. Fallacara...

Khalid, Mahmud (2020). "Libya in the shadows of Islam.. How did Amr ibn al-Aas and his companions conquer Cyrenaica and Tripoli?". aljazeera (in Arabic)...

original on 7 November 2017. Retrieved 28 August 2016. Hand, E. (7 July 2011). "AAS Issues Statement on Proposed Cancellation of James Webb Space Telescope"...

Marketing Sector in Kenya and Somalia" (PDF). Austrian Academy of Sciences (AAS). Retrieved 7 August 2025. Gildenhuys, Anél; Tabane, Tlapeng (5 April 2018)...

has been awarded annually since 2010 by the Association for Asian Studies (AAS). Pioneer Korean studies scholar James Palais is commemorated in the name...

Haroon. In November, Asad, with his band, released its debut album, Rakh Aas. Later the same year, Gumby and Aamir Zaki left the band to work on Najam...

December 2013. Retrieved 2024-02-17. Winter, Frank H (1989). "Harry Bull, American Rocket Pioneer" (PDF). AAS History Series. 9. San Diego: Univelt: 291–312...

Nasser [ar] and Rum band Arabic pop Jordanian/Palestinian folklore/Salwa Al-Aas [ar] 28 April Ya Zareef Al Tool (5:05) O' Statuesque 47Soul Shamstep Palestinian...

Katha 1960 Usne Kaha Tha Young Farida 1960 Patang 1960 Kalpana Munni 1961 Aas Ka Panchhi (as Baby Fareeda) 1961 Kabuliwala Amina A. Khan 1961 Chhaya Young...

Richmond Raceway, Larson recorded a speed of 126.880 miles per hour (204.194 km/h). After qualifying was rained out, he earned the pole based on being the fastest...

Recipients | Division for Planetary Sciences". dps.aas.org. Retrieved 31 May 2019. "AAS Fellows". AAS. Retrieved 30 September 2020. Phil Nicholson's web...

Vice-President: Siim Kallas (RE) / Martin Helme (EKRE) Centre Aab Rahnel Aas Loone Arhipov‡ Höövelson Belobrovtsev‡ Vassiljev Eesmaa Jufereva-Skuratovski...

Archived from the original on June 18, 2023. Retrieved June 13, 2023. "«AAS 75 I [1983] – ACTA APOSTOLICAE SEDIS Regio civili ratione " Samoa Americana...

Ibrahim Hasan, Hasan (1926). تاريخ عمرو بن العاص [The history o Amr ibn al-Aas]. يطلب من ملتزم طبعه ونشره نجيب متري. p. 120. Qasrawi, Abdullah (1997). معجم...

Pyar Da Palla Punjabi 1969 Panchhi Tay Pardesi Punjabi 1969 Piya Millan Ki Aas Urdu 1969 Ghar Damaad Urdu 1969 Aneela Urdu 1969 Ladla Urdu 1969 Andaleeb...

Romani Salim Merchant, Naresh Kamath "Stop" Abbas Tyrewala Sonu Nigam Dhund "Aas Paas" (Female Version) Viju Shah Ibrahim Ashq "Dilbar Mera Aaya" Udit Narayan...

Early 20th-Century Japanese Culture. San Diego, CA: Abstracts of the 2000 AAS Annual Meeting. Archived from the original on February 21, 2001. Retrieved...

Competitors 36 from 4 nations Teams 7 Medalists Thoralf Glad, Thomas Aas, Andreas Brecke, Torleiv Corneliussen, Christian Jebe  Norway Bengt Heyman...

1017/S0305741011001159. S2CID 154689256 – via Cambridge University Press. "AAS 2024 Book Award Winners Announced". 16 February 2024. Archived from the original...

2014. Retrieved March 30, 2014. Reino, Roni (July 4, 2010). "Ilene Woods, N.H.-born voice of Cinderella, dies at 81". Fosters.com. Geo. J. Foster Company...

implications". Acta Anthropologica Sinica. 44 (5): 836–849. doi:10.16359/j.1000-3193/AAS.2025.0064. Mahmood, K.; Morlo, M.; Abbas, S. G.; Babar, M. A.; Khan, M. A...

co-founder of the Archaeology, Astronautics and SETI Research Association (AAS RA). He designed Mystery Park, a theme park located in Interlaken, Switzerland...

Max-Planck-Institut für Astronomie, Heidelberg Henry Norris Russell Lectureship of the AAS (1975) Médaille, Université de Liège (1969) Bruce Medal of the Astronomical...

damage can occur without one's awareness. The American Astronomical Society (AAS) said products meeting the ISO 12312-2 standard avoid risk to one's eyes...

Pos Driver KER PHO TUC CNS KER SON TRI PIR AAS MAD LVS PHO Points 1 Trevor Huddleston 1* 12 5 3 1* 4 5 5 2 1** 1* 10 650 2 Kyle Keller 2 15 4 2 2 8 1...

Lyons, H.G. (1938). "The Growth of the Fellowship". Notes and Records of the Royal Society of London. 1 (1): 40. doi:10.1098/rsnr.1938.0008. Lyons, H.G. (April...

ISBN 0-486-20630-0. {{cite book}}: ISBN / Date incompatibility (help) Coxeter, H. S. M. (1961). Introduction to Geometry. New York: Wiley. Eves, Howard (1963)...

Precise Distance to Our Nearest Cepheid from Gaia DR2". Research Notes of the AAS. 2 (3): 126. Bibcode:2018RNAAS...2..126E. doi:10.3847/2515-5172/aad2d0. S2CID 126329676...

of Anthropology] (in Chinese). 42 (3): 412–421. doi:10.16359/j.1000-3193/aas.2023.0010. Allentoft ME, Sikora M, Refoyo-Martínez A, Irving-Pease EK, Fischer...

Archived from the original on 2017-03-06. Retrieved 2011-05-09. Aleksander Aas (December 10, 2010). "Regarding WebSocket". My Opera Blog. Archived from...

Robin Smith, Romilly Spiers, Gavin Thurston, Darren West, Mark Yates Knut Aas, Ben Adams, James Aldred, Felix Baker, Guillaume Beaudoin, Owen Bissell,...

composites with constituents ranging in size from 129 to 255 amino acyl residues (aas) and exhibiting 4 to 7 transmembrane segments (TMSs). A representative list...

Satellite Constellations on Astronomy | American Astronomical Society". aas.org. Archived from the original on 24 September 2020. Retrieved 16 September...

centuries before the beginning of Latin literature in ancient Rome. A B C D E F G H I L M N O P Q R S T U V full References Peter A. Mackridge; Robert Browning;...

www.asiaa.sinica.edu.tw. Retrieved 7 September 2023. "AAS Names 31 New Fellows for 2021". aas.org. 2 February 2021. Retrieved 10 September 2023. Minor...

Nakchun Award, 1995. Association for Asian Studies (AAS), John Whitney Hall Book Prize, 1998. AAS Lifetime Achievement Award, 2001. The James B. Palais...

Robert (September 2023). Revisiting orbit fits for the Eris-Dysnomia system. AAS Division on Dynamical Astronomy meeting #54. Vol. 55. Bulletin of the American...

PMID 16930306. Corby, P. M.; J. Lyons-Weiler; W.A. Bretz; T.C. Hart; J.A. Aas; T. Bourmenna (November 2005). "Microbial Risk Indicators of Early Childhood...

Concept. 2018 AAS/AIAA Astrodynamics Specialist Conference. Snowbird, Utah, USA. hdl:2014/48626. AAS-18-416. M. J. Wright; J. Herath; H. Hwang; J. Corliss;...

lengthening of the preceding vowel in related forms (Ās, Āṣ in Middle Persian; Aas, Assi in Latin sources); and the Armenian ethnic name Ōsur- (reconstructed...

Kumari was a critical and commercial hit. He then appeared in Mohan Kumar's Aas Ka Panchhi opposite Vyjayanthimala and S. S. Vasan's Gharana opposite Asha...

brand name Durabolin among others, is an androgen and anabolic steroid (AAS) medication which has been used primarily in the treatment of breast cancer...

Kerry (8 November 2023). "Why Are Jets from Disrupted Stars So Rare?". AAS Nova. Stern 2007 Fishman, G. 1995 Fan & Piran 2006 Liang, E. P.; Crider,...

"Petter den Store" [Petter the Great]. Verdens Gang (in Norwegian). Førli Aas, Christina (27 January 2012). "Stordalen benekter stormannsgalskap" [Stordalen...

measurement so that applications such as atomic absorption spectroscopy (AAS) and Inductively coupled plasma atomic emission spectroscopy (ICP) are used...

Archived from the original on 8 May 2014. Retrieved 17 September 2013. Aas, Øystein, ed. (2008). Global Challenges in Recreational Fisheries. John Wiley...

11 S99 EVG IRW S99 RMR DCS PHO CNS MMR IRW 54th 130 2012 Jim Offenbach 31 Chevy PHO LHC MMP S99 IOW BIR LVS SON 15 EVG CNS IOW PIR SMP AAS PHO 67th 29...

2 Minusa – Jursone 3 2 1 5 4 3 1.333 124 116 1.069 3 Fendrick – Ivy 3 1 2 4 3 4 0.750 118 132 0.894 4 Aas – Bjørkesett 3 0 3 3 0 6 0.000 82 126 0.651...

Flyby Parameters Reproduced, Uncertainties Reduced". Research Notes of the AAS. 6 (6): 136. Bibcode:2022RNAAS...6..136D. doi:10.3847/2515-5172/ac7b95. "The...

Anthropologica Sinica (in Chinese). 43 (6): 1006–1026. doi:10.16359/j.1000-3193/AAS.2024.0094. Hartwig, W. C. (2002). The Primate Fossil Record. Cambridge University...

"x as a service" (rendered as *aaS in acronyms) is a phrasal template for any business model in which a product use is offered as a subscription-based...

Elta EL/M-2032 fire control radar. The T-50 is equipped with a Honeywell H-764G embedded global positioning/inertial navigation system and HG9550 radar...

Caliph Umar ibn al-Khattab with the governor of Bahrain, Uthman ibn Abu-al-Aas, dispatching naval expeditions against Thane, Bharuch and Debal. Al-Baladhuri...

195–203. arXiv:astro-ph/0010233. Bibcode:2000A&AS..147..195M. doi:10.1051/aas:2000298. Webster, B. Louise; Murdin, Paul (1972). "Cygnus X-1—a Spectroscopic...

Kelly; Lunine, Jonathan I.; Blaney, Diana L.; American Astronomical Society, AAS Meeting No. 229, id.138.04, January 2017 "Europa Mission to Probe Magnetic...

canopy and reduces risk from lodging and mold. Sugar Ann, 52 days, 1984 AAS winner Sugar Bon, 56 days Amish Snap, 60 days, tall climber, heirloom Cascadia...

Winners". "J. Richard Bond | Gruber Foundation". gruber.yale.edu. "AAS Fellows". AAS. Retrieved 27 September 2020. Shaw Prize 2025 Homepage of Dick Bond...

the H+-PPase family are large proteins of about 770 amino acyl residues (aas) with 15 or 16 putative transmembrane α-helical spanners (TMSs). The N-termini...

Progress / Progress #9, 60–65 days Mr. Big, 60 days, 2000 AAS winner Little Marvel, 63 days, 1934 AAS winner Early Perfection, 65 days Kelvedon Wonder, 65...

cancelled. When MD Helicopters disclosed plans to offer the MD 540F in the AAS program in April 2012, Boeing claimed that they could not sell any "similarly...

มหาวิทยาลัยมหิดล [Bowky, Ms. Pitchsinee Veerasutthimas (born Anchisa Nim-aas), was born on Friday, June 3, 1994. She is 166 cm tall and weighs 42 kg....

Young Communist International). Contents A B C D E F G H J K L M N O P R S T U V W Y Z Kim Aas (born 1970), Danish politician Kim Amb (born 1990), Swedish...

Norwegian University of Science and Technology. Association for Asian Studies (AAS), 1985 Award for Distinguished Contributions to Asian Studies 1987 Foreign...

trims, most notably GT-R (FE-DOHC and 4WS), GT-X (FE-DOHC and AAS), or GT-S (F8 and 4WS or AAS). In other parts of East Asia, the MX-6 name was also used...

was officially changed to Chandney Approach. In 1938, again it was renamed aas Chandni Chowk Street. It was speculated the name was given after Delhi’s...

Sciences. Retrieved 22 May 2022. "Gilles Fontaine (1948–2019)". Bulletin of the AAS. 52 (2). 2020. doi:10.3847/25c2cfeb.c06890d4. S2CID 225727931. Retrieved...

Cycle 25 is Brewing: Early Signs Herald its Onset". Research Notes of the AAS. 4 (2): 30. Bibcode:2020RNAAS...4...30N. doi:10.3847/2515-5172/ab79a1. S2CID 216379844...

Khazanchi (1958) Parakh (1960) - Compounder Keshto Masoom (1960) - CID Officer Aas Ka Panchhi (1961) China Town (1962) - Keshto Prem Patra (1962) Asli Naqli...

1038/s41467-022-28989-z. PMC 8927109. PMID 35297408. Quaas J, Jia H, Smith C, Albright AL, Aas W, Bellouin N, Boucher O, Doutriaux-Boucher M, Forster PM, Grosvenor...

lady), bonde (peasant, farmer) or knægt (boy, married man, servant) Dutch aas, heer (lord, gentleman), vrouw (woman, wife, lady), boer (peasant, farmer)...

Ka Tara Parvati Muqaddar Ka Sikandar Fatima 1979 Suhaag Durga Kapoor 1981 Aas Paas Arun's mother Professor Pyarelal Shanti 1982 Badle Ki Aag Durga Teesri...

A B C D E F G H I J K L M N O P Q R S T U V W X Y Z The DST column shows the months in which Daylight Saving Time, a.k.a. Summer Time, begins and ends...

Antiquarian Society and the American Philosophical Society. The library of the AAS holds original copies of around thirty texts written by Drake. He was elected...

(2): 219–225. Bibcode:2000A&AS..144..219L. doi:10.1051/aas:2000208. S2CID 8496705. Groh, Jose H. (2014). "Early-time spectra of supernovae and their precursor...

indicates an uncertain spectral classification. At the 245th meeting of the AAS it was announced that researchers detected phosphine in the atmosphere of...

infrared/optical detection system was adopted on the later F-14D, with the new AN/AAS-42 IRST and the TCS placed side-by-side. The F-14 was designed to combat...

astronomer/planetary scientist who has worked on comet missions and served as chair of the AAS Division for Planetary Sciences Bruce T. Draine (M.S. 1975, Ph.D. 1978) –...

Li; Bisceglio, Gina; Zou, Fanggeng; Pankratz, Shane; Sando, Sigrid B.; Aasly, Jan O.; Barcikowska, Maria; Siuda, Joanna; Wszolek, Zbigniew K.; Ross,...

No Echo. Retrieved October 18, 2024. Kamiński, Karol (October 18, 2024). "Aas Friends Rust share new single "Lost In Space", European tour coming up"....

Supplement Series. 135 (2): 319–338. Bibcode:1999A&AS..135..319H. doi:10.1051/aas:1999169. ISSN 0365-0138. Gliese 900's database entry at VizieR. Mann, Andrew...

Digital 2024 Chaal Sikander Sami Geo Entertainment Kaffara Salar Sikander 2025 Aas Paas Dr. Saham Naqaab Bilal Jamal ARY Digital Faaslay Zaviyar Green Entertainment...

by C. Strachey at the June 1959 UNESCO Information Processing conference, H.M. Teager and J. McCarthy delivered an unpublished paper "Time-Shared Program...

Gyarah Aapas Ki Baat Bhola Ek Duuje Ke Liye G. Haribabu Vaheta Aansu Vahu Na Aas Paas Jaikishen Ek Hi Bhool Manohar Prasad M.P. Kahani Ek Chor Ki Kantilal...

'Direct Collapse' Black Hole". NASA. 15 July 2025. Retrieved 30 July 2025. AAS Nova (16 July 2025). "A Candidate Direct-Collapse Black Hole in the Infinity...

Katelyn N.; Debes, John H.; Wisniewski, John (January 2020). "WISE J0830+2837: the first Y dwarf from Backyard Worlds: Planet 9". AAS. 52: 132.06. Bibcode:2020AAS...

March 2025). "Confirmed at Last: Barnard's Star Hosts Four Tiny Planets". AAS Nova. Retrieved 11 March 2025. Ribas, I.; Tuomi, M.; Reiners, Ansgar; Butler...

every continent, including Antarctica. Langer, M.C.; Ramezani, J.; Da Rosa, Á.A.S. (2018). "U-Pb age constraints on dinosaur rise from south Brazil". Gondwana...

Ethylene". Angew. Chem. Int. Ed. 15 (10): 630–632. doi:10.1002/anie.197606301. Aas, Øystein; Klemetsen, Anders; Einum, Sigurd; et al. (2011). Atlantic Salmon...

LGY DOM 6 CCS HCY ROU SBO 41st 27 2025 Lee Pulliam Performance 88B Toyota AAS 7 WCS 3 CDL 10 OCS 25 ACE 10 NWS 20 LGY 18 DOM 6 CRW 5 AND 14 FLC 25 SBO...

(link) p. 14. Banning, B. Paul. "AAS Abstracts: China Session 45". Archived from the original on 6 October 2016. "AAS Abstracts: China Session 45". Retrieved...

(m. 1988)​ Children 2 Education New Mexico State University, Alamogordo (AAS) Military service Branch/service United States Air Force Years of service...

audience, where it was a huge success. The film was followed by J. Om Prakash's Aas Ka Panchhi with Rajendra Kumar. For her portrayal, Vyjayanthimala got some...

Archived from the original (PDF) on 13 September 2016. Retrieved 3 May 2016. "AAS Abstracts: China Session 45". Archived from the original on 6 October 2016...

Vaccines". Human Gene Therapy. 33 (21–22): 1213–1216. doi:10.1089/hum.2022.29223.aas. PMID 36375123. "Andrew Bridgen wrong to call mRNA vaccines gene therapy"...

ISSN 0360-9081. Cowley, Charles R. (September 1, 1991). "Laura H. McLaughlin (1893–1991)". Bulletin of the AAS. 23 (4). Northwestern University (Evanston, Ill.)....

intensive care unit". Acta Anaesthesiol. Scand. 9 (62): 1261–1266. doi:10.1111/aas.13161. PMID 29851027. S2CID 44064352.{{cite journal}}: CS1 maint: multiple...

p. 278 "AAS Names Recipients of 2024 Awards & Prizes". American Astronomical Society. 2024-01-11. Retrieved 2024-01-13. "AAS Fellows". AAS. Retrieved...

first career NASCAR pole position with a lap speed of 125.183 mph (201.463 km/h), becoming the youngest pole-sitter in Truck Series history. Elliott secured...

Bhi Tere Shriman Satyawadi Ek Phool Char Kante Saranga 1961 Char Diwari Aas Ka Panchhi Pyaar Ka Saagar Zindagi Aur Khwab Sasural Sanjog Modern Girl Opera...

303 kn; 2,414 km/h) at altitude Mach 1.21, 800 knots (921 mph; 1,482 km/h) at sea level Supercruise: Mach 1.76, 1,162 mph (1,010 kn; 1,870 km/h) at altitude...

Africa. New York, NY: PublicAffairs. ISBN 978-1-61039-159-7. Rustad, Siri Aas; Østby, Gudrun; Nordås, Ragnhild (April 2016). "Artisanal mining, conflict...

William Onsøien Eidem N/A DF  NOR Levi Busch Andresen N/A MF  NOR Nikolai Aas N/A MF  NOR Jakob Ulset No. Pos. Nation Player N/A MF  NOR Marius Ulstad...

Haakonsen FW Jonas Aas Mercantile: GK Sverre Lie DF Harald Schreiner DF Charles Herlofsen MF Thomas Hesselberg Berntzen MF Harald Johansen MF H. Fredrik Holmsen...

Østfold county Bano Abobakar Rashid, 18, Nesodden, Akershus county Aleksander Aas Eriksen, 16, Meråker, Nord-Trøndelag county Henrik Rasmussen, 18, Hadsel...

Olsen (1963) Odd Aas (1963) Frank Soo (1964) Erik Holmberg (1965) Bjørn Spydevold (1966–1967) Brede Borgen (1968) Per Mosgaard (1969) Odd Aas (1970) Arne Pedersen...

Schaller, E. L. (2008). Orbits and Masses of the 2003 EL61 Satellite System. AAS DPS conference 2008. Bulletin of the American Astronomical Society. Vol. 40...

Single-transit Planet Candidate Detected from TESS". Research Notes of the AAS. 8 (2): 53. Bibcode:2024RNAAS...8...53C. doi:10.3847/2515-5172/ad2c85. ISSN 2515-5172...

GA 0 Calvert City M34 Kentucky Dam State Park Airport GA 0 Campbellsville AAS KAAS Taylor County Airport GA 0 Cynthiana 0I8 Cynthiana-Harrison County Airport...

search for hazardous material were presented on the 49th Meeting of the AAS Division for Planetary Sciences, on 20 October 2017. On 17 July 2017, the...

Twin-Engine Aircraft Accidents Following Engine Failures, 1972–1976 NTSB-AAS-79-2" (PDF). Washington, D.C.: National Transportation Safety Board. 1979...

(2023). HelioLinc3D: advances and challenges in multi-night asteroid linking. AAS/Division for Planetary Sciences Meeting #55. Vol. 55. pp. 405–03. Jones,...

Kohler, Susanna (7 July 2017). "Another Possibility for Boyajian's Star". AAS Nova. Retrieved 14 July 2017. Guenzel, Jessica (16 September 2019). "Explain...

Rabia Express Entertainment Ishq Di Chashni Neelima Green Entertainment Aas Paas Kashifa Geo Entertainment Qubool Hai Anisa Express Entertainment Visaal-E-Ishq...

Astrophysics Supplement, 128 (3): 525–540, Bibcode:1998A&AS..128..525P, doi:10.1051/aas:1998393. 435 Ella at AstDyS-2, Asteroids—Dynamic Site Ephemeris · Observation...

and Nodes of the Interstellar Minor Body A/2017 U1". Research Notes of the AAS. 1 (1): 5. arXiv:1711.00445. Bibcode:2017RNAAS...1....5D. doi:10.3847/2515-5172/aa96b4...

original (PDF) on 13 September 2016. Retrieved 3 May 2016. Banning, B. Paul. "AAS Abstracts: China Session 45". aas2.asian-studies.org. Archived from the original...

99-channel sonobuoy receiver, Litton AN/APS-504 radar, AN/ASQ-504 MAD and AN/AAS-40 FLIR. The 27 S-2Ts upgraded were transferred to the ROCN Aviation Command...

The Clear, is a synthetic and orally active anabolic–androgenic steroid (AAS) which was never marketed for medical use. It was developed by Patrick Arnold...

U-2 Dragon Lady VH-92 Patriot X-55 ACCA X-56 X-59 Quesst Electronics AN/AAS-38 Nite Hawk Apache Arrowhead AN/APG-78 Longbow AN/APY-9 AN/FPS-117 AN/SPY-1...

Trajectory Reconstruction and Performance from Launch Through Landing. 23rd AAS/AIAA Spaceflight Mechanics Meeting. February 10–14, 2013. Kauai, Hawaii....

Association named him the Humanist of the Year. The Association for Asian Studies (AAS) conferred its 1987 Award for Distinguished Contributions to Asian Studies...

Year Title Role Network 2020 Aas Shireen...

Year Team No. Make 1 2 3 4 5 6 7 8 9 10 11 12 13 AMSWC Pts Ref 2026 ACR Motorsports 79 Chevy KER PHO 7 TUC SHA CNS TRI SON PIR AAS MAD LVS PHO KER -* -*...

Walker". The Times of India. ISSN 0971-8257. Retrieved 4 December 2024. Aas, Magnus Lutnæs (9 July 2016). "Norges nye stjerne Alan Walker om suksessen:...

Papers. 32 (1): 1112. doi:10.1889/1.1831753. S2CID 110552592. Sluijterman, AAS Seyno (2002). Innovative use of magnetic quadrupoles in cathode-ray tubes...

Eurasian modern humans]. 人类学学报 (in Chinese). 42 (3). doi:10.16359/j.1000-3193/AAS.2023.0010. Osada, Naoki; Kawai, Yosuke (2021). "Exploring models of human...

Shorty Rogers Orchestra conducted by Pete King Arranged and conducted by H. B. Barnum Arranged and conducted by Al De Lory Orchestra directed by Oliver...

in From Imagination to Reality: Mars Exploration Studies, R. Zubrin, ed., AAS Science and Technology Series Volume 91, pp. 339–350 (1997). Larry Page....

1086/106028. "Richard Tousey (1908 - 1997) | American Astronomical Society". aas.org. Archived from the original on 2019-08-19. Retrieved 2017-07-24. F. Zwicky...

Phir Wahi Raat Gendamal Pyaara Dushman Taxi Chor Yeh Kaisa Insaf ? 1981 Aas Paas Master Bandit's associate Biwi-O-Biwi Bulundi Chhupa Chhuppi Commander...

Masteril, and Masteron among others, is an androgen and anabolic steroid (AAS) medication which was used to treat breast cancer in women but is now no...

-на/-но/-нэ/-нө (-na/-no/-ne/-nö) Simple Future -х (болно) (-h (bolno)) Infinitive -х (-h) There are several ways to form negatives in Mongolian. For example:...

2021-06-02. Retrieved 2026-01-30. "George Ellery Hale Prize - Previous Winners". AAS Solar Physics Division. Retrieved 2026-01-28. "Minor Planet Johnharvey"....

Apollo program. Haise is a fellow of the American Astronautical Society (AAS) and the Society of Experimental Test Pilots (SETP); member, Tau Beta Pi...

Princeton University. Retrieved April 26, 2025. "About African American Studies (AAS)". Department of African American Studies. Princeton University. Retrieved...

vitae, II, B, 4: AAS 80 (1988), 92., and Congregation for the Doctrine of the Faith, Instruction Donum vitae, Introduction, 3: AAS 80 (1988), 75. Sallam...

Sønderborg, Denmark (2019) King Abdullah Financial District, Riyad Campus Aas, Aas, Norway (Completed in 2021) European Spallation Source, Lund, Sweden (Completed...

The Association for Asian Studies (AAS) is a scholarly, non-political, and non-profit professional association focusing on Asia and the study of Asia...

androgen/anabolic steroid (AAS) and progestogen medication which is under investigation for potential clinical use. Dimethandrolone is an AAS, and hence is an agonist...

Contaminant in a Micro-meteoritic Underwater Search". Research Notes of the AAS. 7 (10): 220. Bibcode:2023RNAAS...7..220G. doi:10.3847/2515-5172/ad03f9....

Wilson explained in 1960 why AA had refrained from using the term disease: We AAs have never called alcoholism a disease because, technically speaking, it...

Music. Archived from the original on 28 June 2026. Retrieved 20 June 2026. Aas, Magnus Lutnæs (9 July 2016). "Norges nye stjerne Alan Walker om suksessen:...

intended to be carried aloft by a mother ship, such as the four-engined AAS 01A & -B German-origin designs or the French-designed Sud-Est Languedoc four-engined...

(2021-01-25). ""Nik" — The Zero in Vigesimal Maya Mathematics". Bulletin of the AAS. 53 (1). "Wissanu rejects dumping Thai numerals". Bangkok Post. 31 May 2022...

KER PIR SON IRW IRW SHA TRI MAD AAS KER PHO N/A 0 2025 Strike Mamba Racing 72 Chevy KER 8 TUC 10 CNS KER SON TRI PIR AAS MAD 13 LVS 20 PHO 22 11th 225 Fast...

8 September 2019. Retrieved 20 September 2025. "Wins For Indigo Racing & AAS Motorsport At Buriram". dailysportscar.com. 14 May 2019. Retrieved 20 September...

Astronomical Society. January 9, 2017. "May 1 2018 NAS Election". Archived from the original on May 1, 2018. "AAS Fellows". AAS. Retrieved September 27, 2020....

1973 Anmol Badal Aur Bijli Gharana Nya Raasta Naam Ke Nawab Society Zakhmi Aas 1974 Aina Aur Soorat Bano Rani Chahat Dhamaka Dillagi Do Badan Do Tasviren...

remarkable in that every one of the 64 possible codons can be a sense codon.    AAs = FFLLSSSSYYEECCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG Starts...

production of BSA. The full-length BSA precursor polypeptide is 607 amino acids (AAs) in length. An N-terminal 18-residue signal peptide is cut off from the precursor...

Asia-Pacific Artificial Intelligence Association in 2021, recipient of 2015 AAS Dirk Brower Award [4] "for seminal contributions to the theory and practice...

Arkivrådet AAS (redaktörer Olle Ebbinghaus & Ulrika Grönquist) ("Famous Archive Reports and Archive Revues" for Twentieth Years with the Archives Council AAS (editors...

actually the discoverer of the H. post hominem species, and has identified and continues to mentor and lead a group of them, the AAs. As part of her karate training...

triangle has the same length as the corresponding side of the other triangle. AAS: Two angles and a corresponding (non-included) side in a triangle have the...

protocol". Acta Anaesthesiologica Scandinavica. 62 (7): 1014–1019. doi:10.1111/aas.13123. PMID 29664117. Orbach-Zinger S, Bizman I, Firman S, Lev S, Gat R,...

gravitation theories. H. C. Urey Prize of the American Astronomical Society (1986) Helen B. Warner Prize for Astronomy of the AAS (1987) The asteroid 3402...

Archived from the original on June 15, 2018. Retrieved April 22, 2017. "AAS Names 24 New Fellows for 2025". American Astronomical Society. January 13...

Pos Driver PHO KER PIR SON IRW IRW SHA TRI MAD AAS KER PHO Points 1 Sean Hingorani 5 4 16 3 1** 1 2 2* 2 4 1** 3 653 2 Tyler Reif 11 3* 4 2 5 3 1** 1...

Raytheon Australia's facility at Mawson Lakes. The system includes Raytheon AN/AAS-52 Multispectral Targeting System (MTS)-A, an electro-optical/infrared (EO/IR)...

Technologies Active Electronically Scanned Array (AESA) radars, and the AN/AAS-52 Multispectral Targeting System (MTS-A). The system comprises a CEA Operational...

United States Alma mater Goucher College (B.A.) Parsons School of Design (A.A.S.) Occupations Entrepreneur designer Employer eBay (2016–present) Known for...

as specialist Air Attack Supervisors (AAS) to more efficiently manage and utilise aircraft resources. The AAS has responsibility for directing complex...

1038/370094a0. S2CID 4358549. Hammel, H.B. (December 1994). The Spectacular Swan Song of Shoemaker–Levy 9. 185th AAS Meeting. Vol. 26. American Astronomical...

principle". Acta Anaesthesiologica Scandinavica. 64 (8): 1032–1037. doi:10.1111/aas.13603. ISSN 1399-6576. PMID 32270491. Boron, Walter F. (2005). Medical Physiology:...

ships. Flight III of Arleigh Burke-class destroyers starting with USS Jack H. Lucas are equipped with AN/SPY-6 AESA radar from Raytheon, which is 30 times...

371–383. arXiv:astro-ph/9910164. Bibcode:2000A&AS..141..371G. doi:10.1051/aas:2000126. S2CID 14566232. Post-main sequence evolution through helium burning...

(May 2023). "Investigation of Interplanetary Trajectories to Sedna". AAS 23-420, AAS/AIAA Astrodynamics Specialist Conference, Big Sky, Montana, August...

Universität Ulm". uni-ulm (in German). Retrieved 2022-12-04. "Mansour Ashraf | The AAS". www.aasciences.africa. Archived from the original on 2022-11-19. Retrieved...

A M Turaz (Aas Mohammed Turaz) is an Indian poet and lyricist. He has worked in television, music albums and films.[citation needed] He has written the...

landed his first leading role in Kaanch Ki Gudiya (1961). Piya Milan Ki Aas (1961), Suhag Sindoor (1961), Reshmi Roomal (1961) followed, but most of...

arXiv:astro-ph/9912342. Bibcode:2000A&AS..141..491C. doi:10.1051/aas:2000124. S2CID 16273589. Johnson, H. L.; et al. (1966). "UBVRIJKL photometry of the bright...

this time consisting of Ole Alexander Halstensgård, Kristoffer Rygg, Jørn H. Sværen and Tore Ylwizaker, with additional aid and advice from composer Martin...

51 (6): 2889–2906. doi:10.1016/j.csda.2006.11.043. Aas, K.; Czado, C.; Frigessi, A.; Bakken, H. (2009). "Pair-copula constructions of multiple dependence"...

technique for Passive Eccentricity Control (AAS 89-155)". Advances in the Astronautical Sciences. Vol. 69. AAS/NASA. Bibcode:1989ommd.proc...49R. Kikuchi...

un-tethered, hydraulic-powered anthropomorphic exoskeleton developed by Professor H. Kazerooni and his team at Ekso Bionics. It is intended to help soldiers in...

Ella. Raffles was elected a member of the American Antiquarian Society (AAS) in 1822. Raffles returned to Singapore in October 1822. Raffles was pleased...

Focus On AAS" Aviation Week & Space Technology, 4 June 2013. Accessed: 17 June 2014. Archive "EADS Quits Helo Competition To Pursue Uncertain AAS" Aviation...

count Stars in fiction Temming, Maria (15 July 2014). "What is a star?". AAS Sky Publishing, LLC. Retrieved 22 April 2024. Grego, Peter; Mannion, David...

Archived from the original on 2016-05-18. Retrieved 2010-08-12. K. H. Lee; H. Y. Kim; K. H. Park; S. J. Jang; I. C. Park & J. Y. Lee (June 2006). "A Novel...

Piranha IV vor" (in German). 2024-04-15. Retrieved 2024-04-15. "Piranha AAS - Ready for deployment" (PDF). gdels-military-mobility-eurosatory.com. "Neues...

Football players admitted to current or former AAS use. At the collegiate level, surveys show that AAS use among athletes range from 5 percent to 20 percent...

(1968) Padosan (1968) Diwana (1967) Bin Badal Barsaat (1963) Sawan (1959) Aas (1953) Filmfare Award (1972) - Best Film - Anand (1971) Filmfare Award (1981)...

Money?" (PDF). Vol. 106. pp. 327–334. Retrieved November 11, 2025 – via AAS. Andrews, Evan (August 13, 2013) [last updated: May 27, 2025]. "6 World War...

Christian Strømmen Jens Stoltenberg Barack Obama 2013 August 22, 2013 September 17, 2013 Kåre R. Aas [no] Kaare Reidar Aas Erna Solberg Barack Obama...

gland. Non-selective steroidal drugs, called anabolic androgenic steroids (AAS), have been used for various medical purposes, but their side effects limit...

Indonesia". earthquake.usgs.gov. Archived from the original on 12 March 2022. Aas Arbi (12 March 2022). "Gempa Bayah, Satu Rumah di Banjarsari Ambruk". radarbanten...

Supplement Series. 124: 75–84. Bibcode:1997A&AS..124...75T. doi:10.1051/aas:1997181. Oja, T. (August 1985). "Photoelectric photometry of stars near the...

"Discovery of 6 New Orbital Periods for Classical Novae". Research Notes of the AAS. 9 (8): 213. doi:10.3847/2515-5172/adf7a3. ISSN 2515-5172. v t e...

the Nature of the Star's "Great Dimming" Episodes". Research Notes of the AAS. 6 (1): 12. Bibcode:2022RNAAS...6...12N. doi:10.3847/2515-5172/ac4991. ISSN 2515-5172...

– Det er Jens-effekten". NRK News. Oslo: NRK. Retrieved 30 August 2025. Aas, Odd Inge (15 April 2025). "Jens-effekten er massiv. Men i ett område er...