Read other articles:

Pihtipudas Municipio Escudo PihtipudasLocalización de Pihtipudas en FinlandiaCoordenadas 63°22′00″N 25°34′30″E / 63.366666666667, 25.575Entidad Municipio • País Finlandia Finlandia • Región Finlandia CentralSuperficie   • Total 1247,5 km² Población (31 de diciembre de 2017)   • Total 4127 hab. • Densidad 3,31 hab/km²Huso horario UTC+02:00 y UTC+03:00 Sitio web oficial [editar datos en Wikidat...

 

Rover 16 Rover 16. 1947Виробник The Rover Company LimitedРоки виробництва 1937—19401945—1948Попередник(и) Rover Speed 16Наступник(и) Rover P3[en]Клас середній класСтиль кузова седанкабріолетКомпонування Двигун спереду, задній привідДвигун(и) Бензиновий: 2147 см³ к.с.Коробка передач 3 ст. механічнаКолісна база 29...

 

De vliegende ton kan verwijzen naar: De vliegende ton (stripalbum), een stripalbum van Jommeke. De Vliegende Ton, een uitvinding van professor Gobelijn uit diezelfde stripreeks. De bijnaam van het Saab 29 Tunnan-jachtvliegtuig Bekijk alle artikelen waarvan de titel begint met De vliegende ton of met De vliegende ton in de titel. Dit is een doorverwijspagina, bedoeld om de verschillen in betekenis of gebruik van De vliegende ton inzichtelijk te maken. Op deze pagina st...

Cet article dresse la liste des aéroports les plus fréquentés de l'archipel du Cap-Vert. En graphique Les données sont issues de Wikidata, elles-mêmes généralement sourcées par les publications de l'ASA, comme celles-ci[1],[2]. Pour des raisons techniques, il est temporairement impossible d'afficher le graphique qui aurait dû être présenté ici. Voir la requête brute et les sources sur Wikidata. Liste Île Ville OACI AITA Nom Année 2019 Sal Espargos GVAC SID Aéroport internation...

 

AwardNOAA Corps Meritorious Service MedalObverse of the medalTypeMedal (Decoration)Awarded forOutstanding meritorious achievement or service to the United States in a position of considerable responsibility.Country United StatesPresented bythe NOAA CorpsEligibilityMembers of the NOAA Corps, or a member of the Uniformed Services detailed, assigned, or attached to NOAA.Established23 December 2013Service ribbon of the medal PrecedenceNext (higher)Department of Commerce Bronze Medal[...

 

AFC U-19 Championship 2014Informasi turnamenTuan rumah MyanmarJadwalpenyelenggaraan9–23 Oktober 2014Jumlahtim peserta16 (dari 1 konfederasi)Tempatpenyelenggaraan (di Yangon dan Naypyitaw kota)Hasil turnamenJuara Qatar (gelar ke-1)Tempat kedua Korea UtaraStatistik turnamenJumlahpertandingan31Jumlah gol92 (2,97 per pertandingan)Jumlahpenonton233,739 (8 per pertandingan)Pemain terbaik Ahmed Doozandeh[1]Pencetak golterbanyak Ahmed Al Saadi Zabikhillo U...

Kisah Para Rasul 20Frasa menggembalakan jemaat Tuhan dari Kisah Para Rasul 20:28 dalam bahasa Latin (kiri) dan bahasa Yunani (kanan) pada Codex Laudianus (~550 M). Faksimili Scrivener (1874).KitabKisah Para RasulKategoriSejarah gerejaBagian Alkitab KristenPerjanjian BaruUrutan dalamKitab Kristen5← pasal 19 pasal 21 → Kisah Para Rasul 20 (disingkat Kis 20) adalah bagian Kitab Kisah Para Rasul dalam Perjanjian Baru di Alkitab Kristen. Ditulis oleh Lukas, seorang Kristen yang merupak...

 

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

 

Character of Alex Rider novel For other uses, see Alex Rider (disambiguation). Fictional character Alex RiderAlex Rider characterAlex Rider, as portrayed by Otto Farrant in the television series of the same name.First appearanceStormbreaker (2000)Last appearanceNightshade (2020)Created byAnthony HorowitzPortrayed byAlex Pettyfer (Stormbreaker film)Otto Farrant (TV series)In-universe informationAliasFelix Lester, Kevin Blake, Alex Friend, Alex Gardiner, Federico Casali, Abdul Hassan, Alex Bren...

This article was nominated for deletion. The discussion was closed on 17 November 2023 with a consensus to merge the content into the article Evacuations during the 2023 Israel–Hamas war. If you find that such action has not been taken promptly, please consider assisting in the merger instead of re-nominating the article for deletion. To discuss the merger, please use the destination article's talk page. (November 2023) 2023 Indian evacuation operation in Israel Operation AjayPart of the ev...

 

American actor (born 1973) Jonathan Woodward redirects here. For other people, see John Woodward (disambiguation). Jonathan M. WoodwardWoodward in 2008BornJonathan Mark Woodward (1973-11-20) November 20, 1973 (age 50)Moscow, Idaho, U.S.EducationNew York University (BA) Jonathan Mark Woodward (born November 20, 1973) is an American actor known for his roles in Buffy the Vampire Slayer, Angel, and Firefly. Early life and education Born in Moscow, Idaho, Woodward is the younger of two sons ...

 

Tenth major release of Windows NT, released in 2015 Windows 9 redirects here. For the series of operating systems produced from 1995 to 2000, see Windows 9x. For the related operating system for mobile devices, see Windows 10 Mobile. Windows 10Version of the Windows NT operating systemScreenshot of Windows 10 version 22H2, showing the Start menu and Action Center in light themeDeveloperMicrosoftWritten inC, C++, C#, assembly languageOS familyMicrosoft WindowsSource modelClosed-source (source-...

River in BrazilSubaé RiverNative nameRio Subaé (Portuguese)LocationCountryBrazilPhysical characteristicsSource  • locationFeira de Santana Mouth  • locationBaía de Todos os Santos • coordinates12°33′44″S 38°41′45″W / 12.562354°S 38.695873°W / -12.562354; -38.695873Length55 kilometres (34 mi) The Subaé River (Portuguese: Rio Subaé) is a river in Bahia state of Brazil. It has its so...

 

Argentine comedian, actress and screenwriter (born 1982) Malena PichotPichot in 2013Born (1982-07-06) 6 July 1982 (age 41)Buenos Aires, ArgentinaOccupationsComedianactressscreenwriterYears active2008–presentPartnerLeandro Lopatín (2012–present)[1][2]RelativesAgustín Pichot (cousin)YouTube informationChannelsMalena PichotGenreComedySubscribers358,000Total views114,098,102 Creator Awards100,000 subscribers Last updated: 26 July 2022 Malena Pichot (Spanish pr...

 

Suburb of Sydney, New South Wales, AustraliaCaringbahSydney, New South WalesThe Kingsway, CaringbahPopulation11,658 (2016 census)[1]Postcode(s)2229Elevation39 m (128 ft)Location24 km (15 mi) south of Sydney CBDLGA(s)Sutherland ShireState electorate(s) Cronulla MirandaFederal division(s)Cook Suburbs around Caringbah: Sylvania Waters Taren Point Woolooware Miranda Caringbah Dolans Bay Port Hacking Yowie Bay Caringbah South Lilli Pilli Caringbah memorial Car...

                                            الثقافة الأعلام والتراجم الجغرافيا التاريخ الرياضيات العلوم المجتمع التقانات الفلسفة الأديان فهرس البوابات مقدمة تفاصيل للوحة ليوناردو دافينشي موناليزا المرسومة بأسلوب سفوماتو الفن أو...

 

Brazilian footballer Jackson Personal informationFull name Jackson Henrique Gonçalves PereiraDate of birth (1988-06-03) June 3, 1988 (age 35)Place of birth Franca, BrazilHeight 1.76 m (5 ft 9 in)Position(s) Full Back, WingerYouth career2002 Internacional-SP2002–2004 Rio Branco-SP2005–2006 São PauloSenior career*Years Team Apps (Gls)2007–2011 São Paulo 1 (0)2008 → Uberaba (loan) 0 (0)2009 → Mogi Mirim (loan) 14 (0)2009 → São Caetano (loan) 1 (0)2010 → Bota...

 

Frente Unido para la Liberación de las Razas Oprimidas Actividad 1964-1992OrganizaciónLíder Les Kosem y Po DharmaÁrea deoperaciones Vietnam del Norte, Vietnam del Sur y CamboyaRelacionesAliados China Estados Unidos (1970-1975)Enemigos Vietnam del Norte Vietnam del Sur Estados Unidos (1964-1970)Guerras y batallas Guerra de Vietnam[editar datos en Wikidata] El Frente Unido para la Liberación de las Razas Oprimidas (FULRO; francés: Frente unifié de lutte des racing opprimé...

خرة غوش تقسيم إداري البلد إيران  [1] إحداثيات 37°53′43″N 44°35′43″E / 37.89527778°N 44.59527778°E / 37.89527778; 44.59527778  الرمز الجغرافي 127771  تعديل مصدري - تعديل   خرة غوش هي قرية في مقاطعة أرومية، إيران. عدد سكان هذه القرية هو 1,002 في سنة 2006.[2] مراجع ^   صفحة خرة غوش في Ge...

 

Species of moth Plataea diva Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Arthropoda Class: Insecta Order: Lepidoptera Family: Geometridae Tribe: Ourapterygini Genus: Plataea Species: P. diva Binomial name Plataea divaHulst, 1896 Plataea diva is a species of geometrid moth in the family Geometridae. It is found in North America.[1][2][3] The MONA or Hodges number for Plataea diva is 6925.[4] References ^ Plataea diva Report. Integr...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!