Ireneusz Pacula
|
Read other articles:
Не плутати з Сьюзен Слоун (тенісистка). Сьюзен СлоунSusan SloanЗагальна інформаціяГромадянство КанадаНародження 5 квітня 1958(1958-04-05) (65 років)Стетлер, Альберта, КанадаВага 61 кгAlma mater Університет штату Аризона і Університет Британської КолумбіїСпортВид спорту спортивн
Alex Farinelli Portrait officiel, 2019. Fonctions Conseiller national En fonction depuis le 2 décembre 2019 Élection 20 octobre 2019 Législature 51e Groupe politique RL Commission CdF Député au Grand Conseil tessinois avril 2015 – novembre 2019 Législature 2015-2019, 2019-2023 Biographie Date de naissance 16 décembre 1981 (41 ans) Lieu de naissance Comano Nationalité suisse Parti politique Parti libéral-radical Profession économiste modifier Alex Farinelli, né le 16 d...
В іншому мовному розділі є повніша стаття Glitch art(англ.). Ви можете допомогти, розширивши поточну статтю за допомогою перекладу з англійської. Не перекладайте текст, який видається недостовірним або неякісним. Якщо можливо, перевірте текст за посиланнями, поданими в іншомов
راؤول ثاني هدافي المنتخب الإسباني عبر التاريخ. راؤول هو لاعب كرة قدم محترف إسباني سابق شارك في 102 مباراة مع منتخب إسبانيا بين عامي 1996–2006. وهو ثاني هدافي المنتخب الإسباني عبر التاريخ خلف دافيد فيا. سجل 44 هدفاً من 102 مباراة، وفيما يلي قائمة بجميع الأهداف الدولية التي سجلها. قا...
Dalam artikel ini, nama keluarganya adalah Sakugawa. Kanga SakugawaLahir1733Desa Akata, Shuri, Kerajaan RyūkyūMeninggal1815 – 1733; umur -83–-82 tahunNama LainSakugawa Satunushi,[1] Tode Sakugawa[1]GayaTeGuruTakahara Pēchin, KūsankūSiswa TerkemukaSōkon Matsumura Kanga Sakugawa (佐久川 寛賀code: ja is deprecated , Sakugawa Kanga, 1733 - 1815) adalah praktisi Beladiri Okinawa dan kontributor utama bagi perkembangan Beladiri Te (cikal bakal Karate). Gu...
Belawan beralih ke halaman ini. Untuk Untuk kecamatan di Medan, lihat Medan Belawan. Pelabuhan BelawanTerminal penumpang pelabuhan Belawan, MedanLokasi di Sumatera Utara dan Pulau SumatraLokasiNegara IndonesiaLokasiMedan, Sumatera UtaraKoordinat03°47′N 98°42′E / 3.783°N 98.700°E / 3.783; 98.700UN/LOCODEID BLWDetailOperatorDirektorat Jenderal Perhubungan LautPemilikPT Pelindo (Dulu Pelabuhan Indonesia I).JenisPelabuhan penumpang & kargoOtoritas pelabuha...
Infectious disease, often just the flu For other uses, see Influenza (disambiguation), Flu (disambiguation), and Grippe (disambiguation). Flus redirects here. For the diagnostic class of thyroid nodules, see FLUS. Not to be confused with Flue. Medical conditionInfluenzaOther namesflu, the flu, grippe (French for flu)Influenza virus, magnified approximately 100,000 timesSpecialtyInfectious diseaseSymptomsFever, runny nose, sore throat, muscle pain, headache, coughing, fatigueUsual onset1–4 d...
Political nonprofit organization This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) The topic of this article may not meet Wikipedia's notability guidelines for companies and organizations. Please help to demonstrate the notability of the topic by citing reliable secondary sources that are independent of the topic and provide significant coverage of it beyond a mere trivial mention. If notab...
Empress of Northern Zhou (551–582) Empress AshinaEmpress consort of Northern ZhouTenure568–578PredecessorEmpress DuguSuccessorYang LihuaBorn551DiedApril 23, 582(582-04-23) (aged 30–31)BurialApril 29, 582Chenma (陈马), XianyangSpouseEmperor Wu of Northern ZhouPosthumous nameEmpress Wucheng (武成皇后)Empress Wude (武德皇后, per epitaph)[1]HouseAshinaFatherMuqan QaghanSeal Empress Ashina (阿史那皇后, personal name unknown) (551–582) was a Turkic princess, who ...
العلاقات البليزية الفانواتية بليز فانواتو بليز فانواتو تعديل مصدري - تعديل العلاقات البليزية الفانواتية هي العلاقات الثنائية التي تجمع بين بليز وفانواتو.[1][2][3][4][5] مقارنة بين البلدين هذه مقارنة عامة ومرجعية للدولتين: وجه المقارنة بلي...
Seven LionsMontalvo in 2015Background informationBirth nameJeff MontalvoAlso known asDJ Sven (Psytrance alias)[1]BornMarch 31, 1987 (1987-03-31) (age 36)Santa Barbara, California, United StatesGenresMelodic dubstep, electro house, progressive house, trance, psytranceOccupation(s)Musician, DJ, music producerInstrument(s)Drums, D.A.W. (FL Studio), turntables, synthesizer, guitarYears active2010–presentLabelsCasablanca Records, Owsla, Viper Recordings, Anjunabeats, V2 Present...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
1918 Danish Folketing election ← 1915 22 April 1918 April 1920 → All 140 seats in the Folketing71 seats needed for a majority Party Leader % Seats +/– Venstre Klaus Berntsen 29.41 45 +2 Social Democrats Thorvald Stauning 28.66 39 +7 Social Liberals Carl Theodor Zahle 20.67 32 +1 Conservatives Emil Piper 18.29 22 New Industry 1.30 1 New Independents – 0.40 1 +1 This lists parties that won seats. See the complete results below. Prime Minister before Prime Min...
Pontiac Grand Prix2004-2008 Pontiac Grand PrixInformasiProdusenGeneral MotorsMasa produksi1962–2008Bodi & rangkaKelasPersonal luxury car (1962–1987)Full-size car (1996–2008 sedan)Mid-size car (1988–1996, 1996–2002 coupe)KronologiPenerusPontiac G8Pontiac GTO (for the coupe version) Pontiac Grand Prix adalah jajaran mobil yang diproduksi oleh Divisi Pontiac dari General Motors dari tahun 1962 sampai 2002 untuk coupe dan 1988-2008 untuk sedan. Pertama kali diperkenalkan sebagai bag...
English actress and singer (born 1998) Ella HuntHunt interviewed about Anna and the Apocalypse in 2018BornElla Mary L. Grob (1998-04-29) 29 April 1998 (age 25)[1]Westminster, London, EnglandOccupations Actress singer Years active2011–present Ella Hunt (born 29 April 1998) is an English actress and singer. She was nominated for a Scottish BAFTA for her performance in the film Anna and the Apocalypse (2017). On television, she is known for her roles as Ellie Marsden in the I...
Season of television series DamagesSeason 3Region 1 DVD artworkCountry of originUnited StatesNo. of episodes13ReleaseOriginal networkFXOriginal releaseJanuary 25 (2010-01-25) –April 19, 2010 (2010-04-19)Season chronology← PreviousSeason 2Next →Season 4List of episodes The third season of the FX legal drama series Damages premiered on January 25, 2010 and concluded on April 19, 2010. It consisted of 13 episodes, bringing the series total to 39. Damages was create...
49-та гвардійська ракетна дивізія рос. 49-я гвардейская ракетная дивизия На службі 1961–1997Країна СРСР→ БілорусьВид РВСПЧисельність дивізіяШтаб Білорусь,м. ЛідаНагороди Почесні найменування «Будапештська», «Станіславська» 49-та гвардійська ракетна Станіславськ...
Spanish company This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article is an orphan, as no other articles link to it. Please introduce links to this page from related articles; try the Find link tool for suggestions. (August 2023) This article contains content that is written like an advertisement. Please help improve it by removing promotional content and inappropriate external lin...
Винницький Богдан Васильович Народився 22 червня 1953(1953-06-22)с. Чайковичі Самбірського району, Львівської областіПомер 17 лютого 2020(2020-02-17) (66 років)Країна УкраїнаНаціональність українецьДіяльність математик, учитель математики, викладач університетуВідомий завдяк...
Natural area in California, US John Little State Natural ReserveIUCN category V (protected landscape/seascape)Show map of CaliforniaShow map of the United StatesLocation55420 Cabrillo Highway, Monterey County, United StatesNearest cityCambria, CaliforniaCoordinates36°07′N 121°38′W / 36.117°N 121.633°W / 36.117; -121.633Area21 acres (8.5 ha)Established1953Governing bodyCalifornia Department of Parks and Recreation John Little State Natural Reserve...