USP47

USP47
Identifikatori
AliasiUSP47
Vanjski ID-jeviOMIM: 614460 MGI: 1922246 HomoloGene: 9929 GeneCards: USP47
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za USP47
Genomska lokacija za USP47
Bend11p15.3Početak11,841,423 bp[1]
Kraj11,959,323 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za USP47
Genomska lokacija za USP47
Bend7|7 F1Početak111,622,711 bp[2]
Kraj111,710,868 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija WD40-repeat domain binding
GO:0070122 peptidase activity
hydrolase activity
cysteine-type peptidase activity
thiol-dependent deubiquitinase
GO:0001948, GO:0016582 vezivanje za proteine
GO:1904265 deubiquitinase activity
cysteine-type endopeptidase activity
Ćelijska komponenta citoplazma
SCF ubiquitin ligase complex
nukleoplazma
citosol
Biološki proces ubiquitin-dependent protein catabolic process
Proteoliza
negative regulation of apoptotic process
cellular response to UV
negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0100026 Popravka DNK
positive regulation of cell growth
monoubiquitinated protein deubiquitination
base-excision repair
negative regulation of G2/M transition of mitotic cell cycle
GO:0045996 negative regulation of transcription, DNA-templated
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
cellular response to DNA damage stimulus
protein deubiquitination
positive regulation of canonical Wnt signaling pathway
regulation of protein stability
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001282659
NM_017944
NM_001330208

NM_133758
NM_177249
NM_001357952

RefSeq (bjelančevina)
NP_001269588
NP_001317137
NP_060414
NP_001359020
NP_001359021

NP_001359022
NP_001359023
NP_001359024
NP_001359025
NP_001359026
NP_001359027
NP_001359028
NP_001359029
NP_001359030
NP_001359031
NP_001359032

NP_598519
NP_796223
NP_001344881
NP_001390423

Lokacija (UCSC)Chr 11: 11.84 – 11.96 MbChr 7: 111.62 – 111.71 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Ubikvitinska karboksil-terminalna hidrolaza 47 je enzim koji je kod ljudi kodiran genom USP47.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 1.375 aminokiselina, а molekulska težina 157.311 Da.[7]

1020304050
MVPGEENQLVPKEDVFWRCRQNIFDEMKKKFLQIENAAEEPRVLCIIQDT
TNSKTVNERITLNLPASTPVRKLFEDVANKVGYINGTFDLVWGNGINTAD
MAPLDHTSDKSLLDANFEPGKKNFLHLTDKDGEQPQILLEDSSAGEDSVH
DRFIGPLPREGSGGSTSDYVSQSYSYSSILNKSETGYVGLVNQAMTCYLN
SLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRA
IETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINEL
YQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAF
IQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTM
HRIKLNDRMTFPEELDMSTFIDVEDEKSPQTESCTDSGAENEGSCHSDQM
SNDFSNDDGVDEGICLETNSGTEKISKSGLEKNSLIYELFSVMVHSGSAA
GGHYYACIKSFSDEQWYSFNDQHVSRITQEDIKKTHGGSSGSRGYYSSAF
ASSTNAYMLIYRLKDPARNAKFLEVDEYPEHIKNLVQKERELEEQEKRQR
EIERNTCKIKLFCLHPTKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEV
IPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETR
KPDQVFQSYKPGEVMVKVHVVDLKAESVAAPITVRAYLNQTVTEFKQLIS
KAIHLPAETMRIVLERCYNDLRLLSVSSKTLKAEGFFRSNKVFVESSETL
DYQMAFADSHLWKLLDRHANTIRLFVLLPEQSPVSYSKRTAYQKAGGDSG
NVDDDCERVKGPVGSLKSVEAILEESTEKLKSLSLQQQQDGDNGDSSKST
ETSDFENIESPLNERDSSASVDNRELEQHIQTSDPENFQSEERSDSDVNN
DRSTSSVDSDILSSSHSSDTLCNADNAQIPLANGLDSHSITSSRRTKANE
GKKETWDTAEEDSGTDSEYDESGKSRGEMQYMYFKAEPYAADEGSGEGHK
WLMVHVDKRITLAAFKQHLEPFVGVLSSHFKVFRVYASNQEFESVRLNET
LSSFSDDNKITIRLGRALKKGEYRVKVYQLLVNEQEPCKFLLDAVFAKGM
TVRQSKEELIPQLREQCGLELSIDRFRLRKKTWKNPGTVFLDYHIYEEDI
NISSNWEVFLEVLDGVEKMKSMSQLAVLSRRWKPSEMKLDPFQEVVLESS
SVDELREKLSEISGIPLDDIEFAKGRGTFPCDISVLDIHQDLDWNPKVST
LNVWPLYICDDGAVIFYRDKTEELMELTDEQRNELMKKESSRLQKTGHRV
TYSPRKEKALKIYLDGAPNKDLTQD

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000170242 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000059263 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Puente XS, Sanchez LM, Overall CM, Lopez-Otin C (Jul 2003). "Human and mouse proteases: a comparative genomic approach". Nat Rev Genet. 4 (7): 544–58. doi:10.1038/nrg1111. PMID 12838346. S2CID 2856065.
  6. ^ "Entrez Gene: USP47 ubiquitin specific peptidase 47".
  7. ^ "UniProt, Q96K76". Pristupljeno 29. 8. 2021.

Dopunska literatura

Vanjski linkovi

Read other articles:

العلاقات الصينية الجيبوتية الصين جيبوتي   الصين   جيبوتي تعديل مصدري - تعديل   العلاقات الصينية الجيبوتية هي العلاقات الثنائية التي تجمع بين الصين وجيبوتي.[1][2][3][4][5] مقارنة بين البلدين هذه مقارنة عامة ومرجعية للدولتين: وجه المقارنة الصين ج...

 

Aerógrafo de ação simples e sucção Aerógrafo de ação dupla, gravitacional O aerógrafo[1] é um instrumento utilizado para elaborar pinturas e gravuras por meio da pulverização proveniente de uma fonte de ar comprimido, como compressores de ar ou latas de esprei, cuja tinta é expelida pela pressão da fonte de ar. Consiste em um equipamento com gatilho que controla o jato de ar, de modo a projetar o jato no local desejado, seja sugando de um recipiente, seja usando a pressão da ti...

 

Film series based on video game Resident EvilOfficial film series logoDirected by Paul W. S. Anderson (1, 4–6) Alexander Witt (2) Russell Mulcahy (3) Johannes Roberts (7) Written by Paul W. S. Anderson (1–6) Johannes Roberts (7) Based onResident Evilby CapcomStarring Milla Jovovich Michelle Rodriguez Ali Larter Sienna Guillory Oded Fehr Iain Glen Shawn Roberts Wentworth Miller Music by Marco Beltrami (1) Marilyn Manson (1) Jeff Danna (2) Charlie Clouser (3) Tomandandy (4–5) Paul Hasling...

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أبريل 2019) بريندون وينسلو معلومات شخصية الميلاد 30 أغسطس 1969 (54 سنة)  مواطنة نيوزيلندا  الحياة العملية المهنة لاعب اتحاد الرغبي  الرياضة الرغبي  تعديل مصدري - تعد

 

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (مارس 2019) جون بيلي جونز (بالإنجليزية: John Bailey Jones)‏  مناصب عضو مجلس نواب داكوتا الجنوبية   في المنصب1957  – 1960  قاضي المحكمة الجزئية لمنطقة داكوتا الجنوبية   في ا

 

The Fijian records in swimming are the fastest ever performances of swimmers from Fiji, which are recognised and ratified by Fiji Swimming. All records were set in finals unless noted otherwise. Long Course (50 m) Men Event Time Name Club Date Meet Location Ref 50m freestyle 23.18 h Meli Malani Lake Erie Silver 31 March 2016 Speedo Sectionals Geneva, United States [1] 50m freestyle 22.87 h, # David Young  Fiji 28 July 2023 World Championships Fukuoka, Japan [2] 100m frees...

Jalur kereta api Paris–MarseillePemandangan di Massif EsterelIkhtisarSistemSNCFStatusOperasionalLokasiPrancis (Île-de-France,Burgundy, Rhône-Alpes,Provence-Alpes-Côte d'Azur)TerminusGare de Lyon, ParisGare de Marseille-Saint-CharlesOperasiDibuka1847-1856PemilikSNCFOperatorSNCFData teknisPanjang lintas862 km (536 mi)Jenis relLintasan gandaLebar sepur1.435 mm (4 ft 8+1⁄2 in) sepur standarElektrifikasi1.5 kV DC[1] Jalur kereta api dari Paris ke Ma...

 

Баєсові функції втрат: фунція втрат 0-1 (сірий), фунція втрат Севіджа (зелений), логістична функція втрат (помаранчевий), експоненціальна функція втрат (фіолетовий), тангенсна функція втрат (коричневий), квадратична функція втрат (синій). У машинному навчанні та математичній...

 

2022 uncrewed Moon-orbiting NASA mission EM-1 redirects here. For other uses, see EM1 (disambiguation). Artemis 1The Space Launch System launches from Kennedy Space Center's LC-39BNames Artemis I (official) Exploration Mission-1 (EM-1) (formerly) Mission typeUncrewed lunar orbital test flightOperatorNASACOSPAR ID2022-156ASATCAT no.54257Websitewww.nasa.gov/artemis-1Mission duration25 days, 10 hours, 55 minutes, 50 seconds (unofficial)[1][2]25 days, 10 hours and 53...

Sister ship Artem History Russian Empire NameGrom BuilderMetal Works, Saint Petersburg FateSunk during the Battle of Moon Sound, 14 October 1917 General characteristics (as built) Class and typeOrfey-class destroyer Displacement1,260 long tons (1,280 t) Length98 m (321 ft 6 in) Beam9.3 m (30 ft 6 in) Draught3 m (9 ft 10 in) Installed power 4 Vulcan-Thornycroft boilers 30,000 shp (22,000 kW) Propulsion2 shafts, 2 steam turbines Speed3...

 

Book by Charles Rosen The Classical Style: Haydn, Mozart, Beethoven AuthorCharles RosenCountryUnited StatesLanguageEnglishPublishedApril 21, 1971 (Viking Press)Media typePrintPages467 (first edition)ISBN0393317129 The Classical Style: Haydn, Mozart, Beethoven is a book by the American pianist and author Charles Rosen. The book analyses the evolution of style during the Classical period of classical music as it was developed through the works of Joseph Haydn, Wolfgang Amadeus Mozart, and ...

 

Timberlake at the 2013 Cannes Film Festival American entertainer Justin Timberlake has released four video albums and has been featured in thirty-seven music videos, seventeen films, fifteen television shows, and six commercials. He achieved early fame when he appeared in the Disney Channel television series The All-New Mickey Mouse Club, alongside singers Britney Spears and Christina Aguilera and actor Ryan Gosling.[1] Timberlake rose to fame in the late 1990s as the lead singer of t...

2010 American filmGame of DeathFilm PosterDirected byGiorgio SerafiniWritten by Jim Agnew Megan Brown Produced by Billy Dietrich Philippe Martinez Rafael Primorac Starring Wesley Snipes Zoë Bell Gary Daniels Robert Davi CinematographyErik CurtisEdited by Kevin Budzynski Todd C. Ramsay Music byJesse VocciaProductioncompaniesStage 6 FilmsVoltage PicturesDistributed bySony Pictures Home EntertainmentRelease dates November 27, 2010 (2010-11-27) (Japan)[1] February ...

 

1972 studio album by Chet AtkinsPicks on the HitsStudio album by Chet AtkinsReleased1972GenreCountry, popLength27:48LabelRCA VictorChet Atkins chronology Identified!(1971) Picks on the Hits(1972) The Bandit(1972) Alternative Cover Picks on the Hits is the forty-third studio album by guitarist Chet Atkins, released in 1972. It was nominated for the 1972 Grammy Award for Best Country Instrumental Performance but did not win. Chet's duet release with Jerry Reed Me & Chet was also nom...

 

Bank in Netherlands East Indies and Indonesia Former head office of the Bank of Java in Batavia, now Bank Indonesia Museum in Jakarta The Bank of Java (Dutch: De Javasche Bank N.V., abbreviated as DJB) was a note-issuing bank in the Dutch East Indies, founded in 1828, and nationalized in 1951 by the government of Indonesia to become the newly independent country’s central bank, later renamed Bank Indonesia. For more than a century, the Bank of Java was the central institution of the Dutch E...

2001 studio album by DMXThe Great DepressionStudio album by DMXReleasedOctober 23, 2001RecordedJuly 2000-July 2001GenreHardcore hip hopLength72:02LabelRuff RydersDef JamProducerDarrin & Joaquin Dean (exec.)DMX (also exec.)Latarche Nas Collins (co-exec.)Just BlazeSwizz BeatzDame GreasePKBlack KeyKidd KoldDMX chronology ...And Then There Was X(1999) The Great Depression(2001) Grand Champ(2003) Singles from The Great Depression We Right HereReleased: August 14, 2001 Who We BeReleased...

 

This article is about a 19th Century San Francisco newspaper. For other uses, see Golden Era. The Golden Era, October 1865 The Golden Era was a 19th-century San Francisco newspaper. The publication featured the writing of f.e.g. Mark Twain, Bret Harte, Charles Warren Stoddard (writing at first as Pip Pepperpod), Fitz Hugh Ludlow, Adah Isaacs Menken, Ada Clare, Prentice Mulford, Dan De Quille,[1] J. S. Hittell and some women such as Frances Fuller Victor.[2] Stoddard recalled t...

 

قرية غاله العميش  - قرية -  تقسيم إداري البلد  اليمن المحافظة محافظة حجة المديرية مديرية الجميمة العزلة عزلة خطوه الحمارين السكان التعداد السكاني 2004 السكان 56   • الذكور 29   • الإناث 27   • عدد الأسر 10   • عدد المساكن 11 معلومات أخرى التوقيت توقيت اليمن (+3 ...

Indian filmSmart CookieDVD coverProductioncompanyGyanni Inc.Running time65 minutes (volume 1)50 minutes (volume 2)60 minutes (volume 3)CountryIndiaLanguageEnglish Smart Cookie is an Indian English-language VCD series made by Shemaroo Entertainment. The films are educational and targeted for kids ages one to seven.[1][2] The first volume Pyjama Party (2002) won bronze at ‘The American Telly Awards 2006’ and was recognized at ‘Kids First USA’.[3][2] The s...

 

For other places with the same name, see Wiśniewo. Village in Masovian Voivodeship, PolandWiśniewoVillageWiśniewoCoordinates: 52°58′N 21°51′E / 52.967°N 21.850°E / 52.967; 21.850Country PolandVoivodeshipMasovianCountyOstrołękaGminaCzerwin Wiśniewo [viɕˈɲɛvɔ] is a village in the administrative district of Gmina Czerwin, within Ostrołęka County, Masovian Voivodeship, in east-central Poland.[1] It lies approximately 7 kilometres (4 m...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!