TMCO2

TMCO2
Identifikatori
AliasiTMCO2
Vanjski ID-jeviMGI: 1916719 HomoloGene: 77950 GeneCards: TMCO2
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za TMCO2
Genomska lokacija za TMCO2
Bend1p34.2Početak40,245,947 bp[1]
Kraj40,251,684 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za TMCO2
Genomska lokacija za TMCO2
Bend4|4 D2.2Početak120,962,848 bp[2]
Kraj120,966,423 bp[2]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001008740

NM_001081312

RefSeq (bjelančevina)

NP_001008740

n/a

Lokacija (UCSC)Chr 1: 40.25 – 40.25 MbChr 4: 120.96 – 120.97 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Transmembranski upredenozavojnički domen 2 jest protein koji je kod ljudi kodiran genom TMCO2 sa hromosoma 1.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 182 aminokiseline, a molekulska težina 20.071 Da.[6]

1020304050
MSTSSSSSWDNLLESLSLSTVWNWIQASFLGETSAPQQTSLGLLDNLAPA
VQIILRISFLILLGIGIYALWKRSIQSIQKTLLFVITLYKLYKKGSHIFE
ALLANPEGSGLRIQDNNNLFLSLGLQEKILKKLKTVENKMKNLEGIIVAQ
KPATKRDCSSEPYCSCSDCQSPLSTSGFTSPI

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000188800 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000078577 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Transmembrane and coiled-coil domains 2". Pristupljeno 21. 1. 2017.
  6. ^ "UniProt, Q7Z6W1" (jezik: en.). Pristupljeno 5. 12. 2021.CS1 održavanje: nepoznati jezik (link)

Read other articles:

Questa voce o sezione sugli argomenti aziende dei trasporti e aziende metalmeccaniche non cita le fonti necessarie o quelle presenti sono insufficienti. Puoi migliorare questa voce aggiungendo citazioni da fonti attendibili secondo le linee guida sull'uso delle fonti. Segui i suggerimenti del progetto di riferimento. Italia di NavigazioneLogo Stato Italia Fondazione1932 come Italia Flotte Riunite N.G.I. a Genova Chiusura2002 Sede principaleGenova GruppoFinmare SettoreTrasporto P...

 

Keuangan bagian dari Ekonomi Pasar uangPasar Bond  · Pasar bursa efek (Ekuitas)  · Devisa  · Derivatif  · Komoditi  · Uang  · Spot (tunai)  · Pasar OTC  · Real estat  · Ekuitas swasta Pelaku pasarInvestor  · Spekulan  · Lembaga Investor Keuangan korporasiStruktur keuangan  · Penganggaran pemodalan  · Manajemen risiko keuangan  · Merger dan A...

 

اضغط هنا للاطلاع على كيفية قراءة التصنيف أشباه البارياصوراتالعصر: البرمي الأوسط - البرمي المتأخر،265–252 مليون سنة قك ك أ س د ف بر ث ج ط ب ن هيكل عظمي لسكوتوصور في المتحف الأمريكي للتاريخ الطبيعي التصنيف العلمي النطاق: حقيقيات النوى المملكة: حيوانات الشعبة: الحبليات الشعيب...

DistortedPoster promosiGenreHukum ThrillerDitulis olehKim Hyun-jungSutradaraLee Jung-heumPemeranNamgoong MinNegara asalKorea SelatanBahasa asliKoreaProduksiDurasi60 menitDistributorSBSRilisJaringan asliSBSFormat gambar1080i (HDTV)Format audioDolby DigitalRilis asli17 Juli (2017-07-17) –12 September 2017 (2017-9-12)Pranala luarSitus web Distorted[1] (Hangul: 조작; Hanja: 造作; RR: Jojak; lit. Falsify) adalah serial televi...

 

Мінаре́т (тур. Minare від араб. منارة‎, манара, «маяк») — в ісламській архітектурі баштоподібна культова споруда при мечеті, з якої глашатай (муедзин) скликає мусульман на молитву (салят). Зовнішні стіни мінарета нерідко мають художньо-мистецьке оздоблення у вигляді фігу

 

Istana Bogorᮄᮞ᮪ᮒᮔ ᮘᮧᮌᮧᮁIstana BogorLocation within Kabupaten BogorTampilkan peta Kabupaten BogorIstana Bogor (Jawa Barat)Tampilkan peta Jawa BaratIstana Bogor (Jawa)Tampilkan peta JawaIstana Bogor (Indonesia)Tampilkan peta IndonesiaInformasi umumGaya arsitekturArsitektur kolonial BelandaKota BogorNegara IndonesiaKoordinat6°35′52.9″S 106°47′50.5″E / 6.598028°S 106.797361°E / -6.598028; 106.797361Koordinat: 6°35′52.9″S 106°47′50.5...

Chemical compound AM-2233Legal statusLegal status CA: Schedule II DE: Anlage II (Authorized trade only, not prescriptible) NZ: Temporary Class UK: Class B Identifiers IUPAC name 1-[(N-methylpiperidin-2-yl)methyl]-3-(2-iodobenzoyl)indole CAS Number444912-75-8 NPubChem CID10226340ChemSpider8401830 YUNIIZ489688DK3ChEMBLChEMBL364266 YCompTox Dashboard (EPA)DTXSID401014171 ECHA InfoCard100.233.382 Chemical and physical dataFormulaC22H23IN2OMolar mass458.343 ...

 

This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (December 2018) (Learn how and when to remove this template message) President's Trophy Boat Race Annual event since 2011 Current champion Nadubhagam chundan (2019) Course Ashtamudi Lake, Kollam Kerala Trophy President's Trophy The President's Trophy Boat Race (Malayalam: പ്രസിഡന്റ്'സ് ട...

 

Ancient Roman family For the Roman historian Titus Livius, see Livy. Livia Drusilla, wife of the emperor Augustus. The gens Livia was an illustrious plebeian family at ancient Rome. The first of the Livii to obtain the consulship was Marcus Livius Denter in 302 BC, and from his time the Livii supplied the Republic with eight consuls, two censors, a dictator, and a master of the horse. Members of the gens were honoured with three triumphs. In the reign of Augustus, Livia Drusilla was Roman emp...

Kleinplastik: Europäischer Bürgerrechtspreis der Sinti und Roma Der Europäische Bürgerrechtspreis der Sinti und Roma wurde am 7. November 2007 in Heidelberg vom Zentralrat Deutscher Sinti und Roma, dem Dokumentations- und Kulturzentrum Deutscher Sinti und Roma und der Manfred Lautenschläger-Stiftung begründet. Der mit 15.000 Euro dotierte, internationale Preis wird von der Manfred Lautenschläger-Stiftung gestiftet. Die Verleihung erfolgt im Zweijahresturnus, die erstmalige Vergabe erfo...

 

Prison in Dublin, Ireland Mountjoy PrisonView of the prison from North Circular RoadLocation in Central DublinLocationPhibsborough, DublinCoordinates53°21′42″N 06°16′03″W / 53.36167°N 6.26750°W / 53.36167; -6.26750StatusOperationalSecurity classMedium securityCapacity570Population550 (as of 2015)Opened1850; 173 years ago (1850)Managed byIrish Prison ServiceGovernorRay Murtagh Mountjoy Prison (Irish: Príosún Mhuinseo), founded as Moun...

 

American media personality (born 1980) Kim K redirects here. For the Belgian singer, see Kim Kay. Kim KardashianKardashian in 2014BornKimberly Noel Kardashian (1980-10-21) October 21, 1980 (age 43)Los Angeles, California, U.S.Other namesKim Kardashian WestOccupationsMedia personalitysocialitebusinesswomanYears active2003–presentTelevision Keeping Up with the Kardashians Kourtney and Kim Take Miami Kourtney and Kim Take New York The Kardashians Spouses Damon Thomas ​ ...

В Википедии есть статьи о других людях с фамилией Панькин. Валентин Епифанович Панькин Дата рождения 7 января 1931(1931-01-07) Место рождения хутор Вихляевский, Новоаннинский район, Нижне-Волжский край, РСФСР, СССР (ныне — Новоаннинский район, Волгоградская область, Россия...

 

У Вікіпедії є статті про інших людей із прізвищем Яноші. Йозеф Папп де Яноші  ПідполковникЗагальна інформаціяНародження 1875(1875)м. Кошиці,  СловаччинаВійськова службаПриналежність  Австро-Угорщина →  ЗУНР →  ПольщаВійни / битви Українсько-польська війнаКома...

 

Southeast, Washington D.C. high school The Digital Pioneers Academy is an information technology-focused high school in Southeast, Washington D.C.[1][2] The free public charter school is led by Mashea Ashton, the founder and Chief Executive Officer.[1] The school is focused on teaching students modern technology and innovation.[3] Most of the students are from the under-resourced areas east of the Anacostia River in Wards 7 and 8; spaces at the school are award...

Characters from the G.I. Joe franchise Fictional character Tomax & XamotG.I. Joe characterXamot (left) and Tomax (right) as seen in the Sunbow/Marvel 1985 G.I. Joe animated series.First appearanceG.I. Joe: A Real American Hero issue #37 (July 1985)Voiced byCorey Burton (Tomax, Sunbow/Marvel) and Michael Bell (Xamot, Sunbow/Marvel)Stephen Stanton (both, Renegades)Sean Crisden (both, G.I. Joe: Operation Blackout)In-universe informationAffiliationCobraSpecialtyCrimson Guard CommandersFile na...

 

This article is of a series onCriticism of religion By religion Baháˈí Faith Buddhism Christianity Catholic Jehovah's Witnesses Latter Day Saint movement Protestantism Seventh-day Adventist Unification movement Westboro Baptist Church Hinduism Swaminarayan sect Islam Islamism Twelver Shia Islam Wahhabism Jainism Judaism Monotheism New religious movement Neopaganism Scientology Sikhism Yazdânism Zoroastrianism By religious figure Aisha Charles Taze Russell Ellen White Jesus Moses Muhammad ...

 

American college football season 1939 Clemson Tigers footballCotton Bowl Classic championCotton Bowl Classic, W 6–3 vs. Boston CollegeConferenceSouthern ConferenceRankingAPNo. 12Record9–1 (4–0 SoCon)Head coachJess Neely (9th season)CaptainJoe PayneHome stadiumRiggs FieldSeasons← 19381940 → 1939 Southern Conference football standings vte Conf Overall Team W   L   T W   L   T No. 8 Duke $ 5 – 0 – 0 8 – 1 – 0 ...

Season of television series The VoiceSeason 10Promotional posterHosted byCarson DalyCoachesAdam LevinePharrell WilliamsChristina AguileraBlake SheltonNo. of contestants48 artistsWinnerAlisan PorterWinning coachChristina AguileraRunner-upAdam Wakefield No. of episodes28ReleaseOriginal networkNBCOriginal releaseFebruary 29 (2016-02-29) –May 24, 2016 (2016-05-24)Season chronology← PreviousSeason 9Next →Season 11 The tenth season of the American reality talent show ...

 

Bank for U.S. military members Armed Forces BankIndustryBankingFounded1907; 116 years ago (1907)HeadquartersFort Leavenworth, Kansas, U.S.ParentDickinson Financial CorporationWebsiteafbank.com Armed Forces Bank (AFB) is a bank servicing members of the United States Armed Forces and their family members. History Armed Forces Bank was founded in 1907 in Fort Leavenworth, Kansas, where it is currently headquartered.[1][2] AFB and its sister bank, Academy Bank, a...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!