SPSB1

SPSB1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2JK9, 3F2O

Identifikatori
AliasiSPSB1
Vanjski ID-jeviOMIM: 611657 MGI: 1921896 HomoloGene: 11832 GeneCards: SPSB1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za SPSB1
Genomska lokacija za SPSB1
Bend1p36.22Početak9,292,894 bp[1]
Kraj9,369,532 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za SPSB1
Genomska lokacija za SPSB1
Bend4|4 E2Početak149,980,740 bp[2]
Kraj150,039,500 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
GO:0050372 aktivnost sa transferazom ubikvitina
ubiquitin ligase-substrate adaptor activity
Ćelijska komponenta citoplazma
citosol
SCF ubiquitin ligase complex
Biološki proces protein ubiquitination
protein polyubiquitination
Posttranslacione modifikacije
ubiquitin-dependent protein catabolic process
proteasome-mediated ubiquitin-dependent protein catabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_025106

NM_029035

RefSeq (bjelančevina)

NP_079382

NP_083311

Lokacija (UCSC)Chr 1: 9.29 – 9.37 MbChr 4: 149.98 – 150.04 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein SPRY sa domenim SOCS-kutije proteina 1 jest protein koji je kod ljudi kodiran genom SPSB1 sa hromosoma 1.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 273 aminokiseline, a molekulska težina 30.942 Da.[8]

1020304050
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDV
QLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVW
QITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLY
HDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVA
FRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALG
RERLGEIHTLPLPASLKAYLLYQ

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000171621 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000039911 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Wang D, Li Z, Messing EM, Wu G (Apr 2005). "The SPRY domain-containing SOCS box protein 1 (SSB-1) interacts with MET and enhances the hepatocyte growth factor-induced Erk-Elk-1-serum response element pathway". J Biol Chem. 280 (16): 16393–401. doi:10.1074/jbc.M413897200. PMID 15713673.
  6. ^ Kile BT, Schulman BA, Alexander WS, Nicola NA, Martin HM, Hilton DJ (Jun 2002). "The SOCS box: a tale of destruction and degradation". Trends Biochem Sci. 27 (5): 235–41. doi:10.1016/S0968-0004(02)02085-6. PMID 12076535.
  7. ^ "Entrez Gene: SPSB1 splA/ryanodine receptor domain and SOCS box containing 1".
  8. ^ "UniProt, Q96BD6" (jezik: eng.). Pristupljeno 5. 12. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura

Read other articles:

BatuceperKecamatanPeta lokasi Kecamatan BatuceperNegara IndonesiaProvinsiBantenKotaTangerangPemerintahan • CamatH. Nurhidayatullah. S.IP. M.SIPopulasi • Total70,360 jiwa (2.001) jiwaKode Kemendagri36.71.03 Kode BPS3671050 Luas7,22 km²Desa/kelurahan7 Jalan di Patuceper Batuceper adalah sebuah kecamatan di Kota Tangerang, Provinsi Banten, Indonesia. Sejarah Wilayah kecamatan ini merupakan bekas tanah partikulir milik Tan Liok Tiauw Sia dan Landheer van Batoe Tjeppe...

 

Republik Filipina Nama Pambansang Watawat Pemakaian Bendera dan bendera kapal nasional Perbandingan 1:2 Dipakai 12 Juni 1898 Rancangan Bendera triwarna, warna biru (atas), warna merah (bawah) dan warna putih berbentu segitiga yang didalamnya terdapat tiga bintang emas bersegi lima dan ksatu matahari emas dengan delapan sinar. Perancang Emilio Aguinaldo Varian bendera Republik Filipina Nama Bendera masa perang Pemakaian Bendera kapal perang Rasio bendera: 1:2 Bendera Filipina, dalam Bahasa Tag...

 

Frankie and Johnny in the Clair de LunePoster for the 1987 Westside Theatre productionWritten byTerrence McNallyCharacters Frankie, a waitress Johnny, a short order cook Date premieredJune 2, 1987 (1987-06-02)Place premieredManhattan Theatre ClubOriginal languageEnglishSettingA one-room apartment in Manhattan Frankie and Johnny in the Clair de Lune is a two-character play by Terrence McNally that was first performed off-Broadway in 1987. Plot The play focuses on two lonely, mid...

  لمعانٍ أخرى، طالع المنسي (توضيح). المنسي المنسي قضاء حيفا إحداثيات 32°35′42″N 35°10′22″E / 32.59500°N 35.17278°E / 32.59500; 35.17278 السكان 1200 (1945) المساحة 12,272 دونم تاريخ التهجير 12 -13 إبريل 1948 سبب التهجير هجوم عسكري من قبل قوات اليشوب المستعمرات الحالية مدراخ عوز [الإنجليزية...

 

2023 oil spill in the Philippines MT Princess Empress oil spillMT Princess Empress, the oil tanker that caused the oil spillLocationTablas Strait, Philippines[a]Coordinates13°19′03″N 121°31′47″E / 13.3175°N 121.529722°E / 13.3175; 121.529722[1]DateFebruary 28, 2023; 8 months ago (2023-02-28)CauseCauseSinking of MT Princess EmpressCasualties203 non-fatal injuries[2]OperatorRDC Reield Marine Services[3]Spill c...

 

Bujur node menaik. Bujur node menaik (☊ atau Ω) adalah salah satu elemen orbit yang digunakan untuk menentukan orbit suatu benda di angkasa. Bujru node menaik merupakan sudut dari arah referensi yang disebut asal bujur menuju arah node menaik yang diukur pada bidang referensi.[1] Bidang referensi dan asal bujur yang sering digunakan meliputi: Untuk orbit geosentris, bidang khatulistiwa Bumi adalah bidang referensi, dan Titik Pertama Aries adalah asal bujur. DAlam hal ini, bujur jug...

Artikel ini membutuhkan rujukan tambahan agar kualitasnya dapat dipastikan. Mohon bantu kami mengembangkan artikel ini dengan cara menambahkan rujukan ke sumber tepercaya. Pernyataan tak bersumber bisa saja dipertentangkan dan dihapus.Cari sumber: Universitas Sains Malaysia – berita · surat kabar · buku · cendekiawan · JSTOR (November 2013) Artikel ini perlu diterjemahkan dari bahasa Melayu ke bahasa Indonesia. Artikel ini ditulis atau diterjemahkan se...

 

Legislative branch of the state government of Wisconsin Wisconsin State Legislature106th Wisconsin LegislatureTypeTypeBicameral HousesSenate AssemblyLeadershipPresident of the SenateChris Kapenga (R) since January 4, 2021 Senate Majority LeaderDevin LeMahieu (R) since January 4, 2021 Speaker of the AssemblyRobin Vos (R) since January 7, 2013 Assembly Majority LeaderTyler August (R) since January 3, 2023 StructureSeats13233 Senators[1]99 Representatives[2]Senat...

 

Ramón Cáceres, responsable de la firma de la Convención domínico-americana La Convención domínico-americana fue un acuerdo firmado entre el gobierno de la República Dominicana y de Estados Unidos en 1907, durante las presidencias de Ramón Cáceres y Theodore Roosevelt en los respectivos países. El convenio supuso el control total de las aduanas dominicanas por parte del gobierno estadounidense con el fin de pagar la deuda externa contraída durante los años anteriores por los mandat...

Federação de Voleibol da Macedónia do Norte Federação de Voleibol da Macedónia do Norte Tipo Desportiva Fundação 1993 Sede Escópia Línguas oficiais macedónia Presidente Petar Jovanovski Organização Zoran Karanović Sítio oficial Site oficial A Federação de Voleibol da Macedónia do Norte, ou Macedônia do Norte, (em macedónio: Одбојкарска федерација на Македонија, Odbojkarska Federatsija Na Makedonija) é uma organização fundada em 1993 que ...

 

2004 French science fiction film by Enki Bilal ImmortalTheatrical release posterDirected byEnki BilalWritten byEnki Bilal (scenario, adaptation and dialogue)Serge Lehman (script)Based onComic book La Foire aux immortels by Enki BilalProduced byCharles GassotStarring Linda Hardy Thomas Kretschmann Charlotte Rampling Frédéric Pierrot Jean-Louis Trintignant CinematographyPascal GennesseauxEdited byVéronique ParnetMusic byGoran VejvodaProductioncompaniesDuran Entertainment Quantic DreamDistrib...

 

This article is about the Australian federal electorate. For other uses, see Electoral district of Brisbane. Australian federal electoral division BrisbaneAustralian House of Representatives DivisionDivision of Brisbane in Queensland, as of the 2019 federal electionCreated1901MPStephen BatesPartyGreensNamesakeBrisbaneElectors125,241 (2022)Area57 km2 (22.0 sq mi)DemographicInner metropolitan The Division of Brisbane is an Australian electoral division in the state of Queens...

2003 novel by David Liss The Coffee Trader First edition coverAuthorDavid LissCover artistView Down a Corridor, by HoogstratenCountryUnited StatesLanguageEnglishGenreHistorical novelPublished2003 (Random House)Media typePrint (hardcover)Pages394ISBN978-0-8129-7032-6OCLC49531074 The Coffee Trader is a historical novel by David Liss, set in 17th-century Amsterdam. The story revolves around the activities of commodity trader Miguel Lienzo, who is a Jewish refugee from the Portuguese In...

 

Department of the Roman Curia Dicastery for Divine Worship and the Discipline of the SacramentsLatin: Dicasterium de Cultu Divino et Disciplina SacramentorumItalian: Dicastero per il Culto Divino e la Disciplina dei SacramentiCoat of arms of the Holy SeePalazzo delle Congregazioni in Piazza Pio XII (in front of St. Peter's Square) is the workplace for most congregations of the Roman CuriaDicastery overviewFormedMarch 1, 1989; 34 years ago (1989-03-01) (as a Congregation with...

 

US animated television series based on Laurel and Hardy Laurel and HardyGenreComedyVoices ofLarry HarmonJim MacGeorgeHal SmithDon MessickJanet WaldoDoug YoungAllan MelvinPaul FreesNarrated byPaul FreesTheme music composerTed NicholsCountry of originUnited StatesOriginal languageEnglishNo. of seasons1No. of episodes156ProductionProducersWilliam HannaJoseph BarberaDavid L. WolperRunning time5 minutesProduction companiesLarry Harmon PicturesDavid L. Wolper ProductionsHanna-Barbera ProductionsOri...

Cattedrale di Sant'AlessandroFacciataStato Italia RegioneLombardia LocalitàBergamo IndirizzoPiazza Duomo Coordinate45°42′11.92″N 9°39′46.44″E / 45.70331°N 9.6629°E45.70331; 9.6629Coordinate: 45°42′11.92″N 9°39′46.44″E / 45.70331°N 9.6629°E45.70331; 9.6629 Religionecattolica di rito romano Titolaresant'Alessandro di Bergamo Diocesi Bergamo ArchitettoFilarete ed altri Stile architettoniconeoclassico (esterno)barocco (interno) Inizio ...

 

This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: John Thorne civil servant – news · newspapers · books · scholar · JSTOR (December 2009) Sir John Anderson Thorne KCIE, CSI (17 October 1888 – 29 April 1964) was a senior civil servant in the Indian Civil Service who served as the Secretary of t...

 

Древнешведский язык Страны Швеция, Финляндия и Аландские острова Вымер развился в современный шведский язык к XVI веку Классификация Категория Языки Евразии Индоевропейская семья Германская ветвь Северогерманская группа Восточноскандинавская подгруппа Письменность ...

Pour les articles homonymes, voir Rugby et XV. Rugby à XVRugby union Fédération internationale World Rugby(nom actuel de l'IRB, fondée en 1886) Joueurs licenciés 3 200 000 (2016)[1] Joueurs pratiquants 8 500 000 (2016)[1] Champion(ne)(s) du monde en titre Afrique du Sud (2023) Nouvelle-Zélande (2022) Un attaquant (en noir et jaune) va aplatir le ballon dans l'en-but alors que ses adversaires (en blanc et marine) n'arrivent pas à le plaquer. modifier  Le rugby ...

 

51°0′N 11°30′W / 51.000°N 11.500°W / 51.000; -11.500 البحر الكلتيMhuir Cheilteach (بالأيرلندية) البحر الكلتي وخليج بسكايالموقع الجغرافي / الإداريالإحداثيات 51°N 03°E / 51°N 3°E / 51; 3 (البحر الكلتي)جزء من المحيط الأطلسي الشمالي القارة أوروبادول الحوض جمهورية أيرلندا — فرنسا ...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!