PXMP4

PXMP4
Identifikatori
AliasiPXMP4
Vanjski ID-jeviOMIM: 616397 MGI: 1891701 HomoloGene: 5237 GeneCards: PXMP4
Lokacija gena (čovjek)
Hromosom 20 (čovjek)
Hrom.Hromosom 20 (čovjek)[1]
Hromosom 20 (čovjek)
Genomska lokacija za PXMP4
Genomska lokacija za PXMP4
Bend20q11.22Početak33,702,758 bp[1]
Kraj33,720,319 bp[1]
Lokacija gena (miš)
Hromosom 2 (miš)
Hrom.Hromosom 2 (miš)[2]
Hromosom 2 (miš)
Genomska lokacija za PXMP4
Genomska lokacija za PXMP4
Bend2|2 H1Početak154,427,678 bp[2]
Kraj154,445,628 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta integral component of membrane
peroxisomal membrane
Peroksisom
membrana
Biološki proces GO:0022610 biološki proces
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_183397
NM_007238

NM_021534

RefSeq (bjelančevina)

NP_009169
NP_899634

NP_067509

Lokacija (UCSC)Chr 20: 33.7 – 33.72 MbChr 2: 154.43 – 154.45 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Perokisomni membranski protein 4 je protein koji je kod ljudi kodiran genom PXMP4.[5][6]

Aminokiselinska sekvenca

Simboli
1020304050
MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALV
MTFLFRNGSLQEKLWAILQATYIHSWNLARFVFTYKGLRALQSYIQGKTY
PAHAFLAAFLGGILVFGENNNINSQINMYLLSRVLFALSRLAVEKGYIPE
PRWDPFPLLTAVVWGLVLWLFEYHRSTLQPSLQSSMTYLYEDSNVWHDIS
DFLVYNKSRPSN

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000101417 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000000876 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Reguenga C, Oliveira ME, Gouveia AM, Eckerskorn C, Sa-Miranda C, Azevedo JE (Jul 1999). "Identification of a 24 kDa intrinsic membrane protein from mammalian peroxisomes". Biochim Biophys Acta. 1445 (3): 337–41. doi:10.1016/s0167-4781(99)00061-5. PMID 10366717.
  6. ^ "Entrez Gene: PXMP4 peroxisomal membrane protein 4, 24kDa".

Dopunska literatura

Šablon:Refbegin2

Read other articles:

Pertempuran TondibiBagian dari Invasi Songhai oleh MarokoTanggal13 Maret 1591LokasiTondibi, MaliHasil Kemenangan besar Maroko Jatuhnya Kerajaan SonghaiPihak terlibat Kesultanan Maroko Kerajaan SonghaiTokoh dan pemimpin Judar Pasha Askia Ishaq IIKekuatan 2.500 infantri yang dilengkapi oleh Arquebus 500 infantri yang dilengkapi dengan busur, tombak dan pedang 1.500 kavaleri ringan 6 meriam 9.700 infantri 12.500 kavaleri 1,000 hewan ternakKorban Tidak diketahui Tidak diketahui, tetapi besar Pert...

 

الزوجة العذراءمعلومات عامةالصنف الفني جريمة، غموضتاريخ الصدور 1958اللغة الأصلية العربيةالبلد الجمهورية العربية المتحدةالطاقمالمخرج السيد بدير البطولة فاتن حمامة، أحمد مظهر، عماد حمديالتصوير محمود نــصر تعديل - تعديل مصدري - تعديل ويكي بيانات الزوجة العذراء هو فيلم جريمة

 

Althausen Stadt Bad Königshofen im Grabfeld Koordinaten: 50° 16′ N, 10° 28′ O50.2674210.47078Koordinaten: 50° 16′ 3″ N, 10° 28′ 15″ O Einwohner: 283 (2006)[1] Eingemeindung: 1. Juli 1972 Postleitzahl: 97631 Vorwahl: 09761 Althausen (Bayern) Lage von Althausen in Bayern Althausen ist ein Gemeindeteil der Stadt Bad Königshofen im Grabfeld im unterfränkischen Landkreis Rhön-Grabfeld (Bayern). Inhaltsverzeichn...

Kristus di Salib, karya Francisco de Zurbarán, 1627. Pernyataan Pilate di pakukan di salib pada bagian atas Yesus. Quod scripsi, scripsi (Latin untuk Apa yang kutulis, tetap tertulis) adalah sebuah peribahasa Latin. Peribahasa tersebut dikenal sebagai pernyataan yang dibuat oleh Pontius Pilatus dalam Alkitab saat menjawab para imam Yahudi yang menentang tulisannya di bagian tanda (titulus) yang digantung di atas Yesus pada saat Penyaliban-Nya. Peribahasa tersebut banyak ditemukan dalam Alkit...

 

2020 studio album by Lil DurkThe VoiceStudio album by Lil DurkReleasedDecember 24, 2020 (2020-12-24)Genre Hip hop drill Length38:38Label Only the Family Alamo Geffen ProducerAkelAuraAyeTMAyo BleuChopsquad DJDeAvonte KimbleDYG. FreshGo GrizzlyHaganHitmakaIts2ezzyJay LVJohn LamJoseph LeytrickLowLowTurnMeUpMalikOTBMetro BoominMorgan O'ConnorTahj MoneyThe SuperiorsTM88Touch of TrentTre GilliamTurnMeUpJoshVaniWassupBansWillskeatingYoung Cuttajp:Trill DynastyLil Durk chronolo...

 

This article needs to be updated. Please help update this article to reflect recent events or newly available information. (May 2021) Part of a series on theCulture of the Democratic Republic of the Congo History People Languages Cuisine Religion Music Media Radio Television Cinema Sport Monuments World Heritage Sites Symbols Flag Coat of arms National anthem  Democratic Republic of the Congo portalvte Mass media in the Democratic Republic of the Congo are both nationally and interna...

Species of moth Hypocrita plagifera Scientific classification Kingdom: Animalia Phylum: Arthropoda Class: Insecta Order: Lepidoptera Family: Erebidae Genus: Hypocrita Species: H. plagifera Binomial name Hypocrita plagifera(C. & R. Felder, 1862) Synonyms Esthema plagifera C. & R. Felder, 1862 Eucyane uranigera Walker, 1866 Hypocrita plagifera is a moth of the family Erebidae. It was described by Cajetan and Rudolf Felder in 1862. It is found in Brazil.[1] References ^ Hypo...

 

North Germanic language Gutamål redirects here. It is not to be confused with Gotlandic, the local Swedish dialect spoken on Gotland and Fårö, or Götamål, the dialects of Swedish spoken in the Götaland provinces. Gutnish Gutnic Gutiske[1] Gutamål Native toSwedenRegionGotland, FåröNative speakers(~2,000–5,000 cited 1998)[2][3]Language familyIndo-European GermanicNorth GermanicGutnishEarly formsOld Norse Old Gutnish Dialects Mainland Gutnish (Laumål)Får...

 

Guest houses in Luang Prabang. Tourism in Laos is governed by a ministry-level government agency, the Lao National Tourism Administration (LNTA). Statistics Annual statistics Year Tourist Arrivals Change Source 2020 886,447 81.5%[1] [1] 2019 4,791,065 14.4% 2018 4,186,432 8.2% [2] 2017 3,868,838 8.7% [3] 2016 4,239,047 9.5% [4] 2015 4,684,429 12.6% [5] 2014 4,158,719 10.0% [6] 2013 3,779,490 13.5% [7] 2012 3,330,072 22.3% 2011 2,723,564 ...

Putri MarinoPutri pada tahun 2017Nama asalᬦᬶᬮᬸᬄᬤ᭄ᬳᬃᬫᬧᬸᬢ᭄ᬭᬶᬫᬭᬶᬦᭀLahirNi Luh Dharma Putri Marino4 Agustus 1993 (umur 30)Denpasar, Bali, IndonesiaKebangsaanIndonesiaPekerjaanAktrismodelpresenterTahun aktif2013—sekarangSuami/istriChicco Jerikho Jarumillind ​ ​(m. 2018)​Anak1KeluargaSitha Marino (adik)PenghargaanDaftar penghargaanTanda tangan Ni Luh Dharma Putri Marino (Bahasa Bali: ᬦᬶᬮᬸᬄᬤ᭄...

 

Urban Meyer, head coach of the Ohio State Buckeyes from 2012 to 2018 The Ohio State Buckeyes college football team represents the Ohio State University in the East Division of the Big Ten Conference. The Buckeyes compete as part of the NCAA Division I Football Bowl Subdivision. The program has had 25 coaches since it began play during the 1890 season.[1] The Buckeyes have played over 1,200 games over 125 seasons. In those seasons, nine head coaches have led the Buckeyes to postseason ...

 

قلعة الحمىجزء من القلعة الأثريةمعلومات عامةنوع المبنى قلعة أثريةالمكان منطقة جازان، محافظة ضمدالبلد  السعوديةتعديل - تعديل مصدري - تعديل ويكي بيانات قلعة الحمى موقع أثري في محافظة ضمد جنوب المملكة العربية السعودية. نبذة تاريخية مدينة ضمد معدودة في المدن التاريخية بمنط...

WikiScannerJenis situsSitus databaseBahasaInggris, Belanda, Prancis, Jerman, Italia, Jepang, Polandia, ChinaPemilikVirgil GriffithPenciptaVirgil GriffithSitus webwikiscanner.virgil.grKomersialTidakDiluncurkan14 Agustus 2007StatusNonaktif WikiScanner atau Wikipedia Scanner adalah situs database memuat jutaan suntingan ensiklopedia online Wikipedia yang dilakukan secara anonim oleh organisasi, kelompok atau perusahaan tertentu yang secara langsung berdampak pada artikel terkait. Dengan kata lai...

 

Международная ассоциация геодезииангл. International Association of Geodesy, IAG Офис  Германия, Мюнхен Локация  Финляндия[1] Тип организации Международная организация Официальные языки Английский Руководители Президент Michael G. Sideris Вице-президент Chris Rizos Генеральный секретарь...

 

Early Netherlandish painter The Morrison Triptych, Toledo Museum of Art The Master of the Morrison Triptych is the name given to an unknown Early Netherlandish painter active in Antwerp around 1500-1510. He is named for the Morrison Triptych, now in Toledo, Ohio, United States, which is described below. The same master is attributed an Adoration of the Magi with donor portrait, in the Philadelphia Museum of Art, c. 1504, probably the side-wing of another triptych. It is dateable by the stage ...

1984 film by Fritz Kiersch Children of the CornOriginal 1984 theatrical release posterDirected byFritz KierschScreenplay byGeorge GoldsmithBased onChildren of the Cornby Stephen KingProduced by Donald P. Borchers Terence Kirby Starring Peter Horton Linda Hamilton John Franklin Courtney Gains Robby Kiger Anne Marie McEvoy Julie Maddalena R. G. Armstrong CinematographyJoão Fernandes (as Raoul Lomas)Edited byHarry KeramidasMusic byJonathan EliasProductioncompanies Angeles Entertainment Group Ci...

 

Goran Hadžić (Sirilik Serbia : Горан Хаџић , diucapkan [ɡǒran xǎdʒiːtɕ] ; 7 September 1958 – 12 Juli 2016) adalah seorang politikus Serbia Kroasia dan Presiden Republik Serbia Krajina yang memproklamirkan diri, selama Perang Kemerdekaan Kroasia. Ia dituduh melakukan kejahatan terhadap kemanusiaan dan pelanggaran hukum dan kebiasaan perang oleh Pengadilan Kriminal Internasional untuk bekas Yugoslavia.[1]Goran HadžićГоран ХаџићHadžić pada pena...

 

אהרון גורביץ'אין תמונה חופשית לידה 1973 (בן 51 בערך)מוסקבה, ברית המועצות מדינה רוסיה מקום פעילות רוסיה השתייכות חסידות חבד תפקידים נוספים הרב הראשי של כוחות הביטחון הרוסיים רבותיו הרבי מליובאוויטש פרסים והוקרה עיטור הידידות (רוסיה) הרב אהרון גורביץ' (נולד בשנת 1973). הוא הרב...

Cet article est une ébauche concernant le sport et Valence. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations du projet sport. Stade Georges-PompidouGénéralitésSurnom PompidouNom complet Stade du Président Georges-PompidouAdresse Rue Jean-Vilar, 26000 ValenceConstruction et ouvertureOuverture 1974UtilisationClubs résidents Olympique de Valence et Valence Romans Drôme rugbyPropriétaire Ville de ValenceAdministration Ville de Valence (...

 

ХристианствоБиблия Ветхий Завет Новый Завет Евангелие Десять заповедей Нагорная проповедь Апокрифы Бог, Троица Бог Отец Иисус Христос Святой Дух История христианства Апостолы Хронология христианства Раннее христианство Гностическое христианство Вселенские соборы Н...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!