CREG1

CREG1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1XHN

Identifikatori
AliasiCREG1
Vanjski ID-jeviOMIM: 618055 MGI: 1344382 HomoloGene: 31199 GeneCards: CREG1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za CREG1
Genomska lokacija za CREG1
Bend1q24.2Početak167,529,117 bp[1]
Kraj167,553,805 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za CREG1
Genomska lokacija za CREG1
Bend1|1 H2.3Početak165,591,315 bp[2]
Kraj165,602,877 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija transcription factor binding
GO:0001106 transcription corepressor activity
Ćelijska komponenta Egzosom
transcription regulator complex
extracellular region
Vanćelijsko
azurophil granule lumen
Biološki proces GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
multicellular organism development
regulation of growth
Ćelijska proliferacija
GO:0009373 regulation of transcription, DNA-templated
negative regulation of nucleic acid-templated transcription
neutrophil degranulation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003851

NM_011804

RefSeq (bjelančevina)

NP_003842

NP_035934

Lokacija (UCSC)Chr 1: 167.53 – 167.55 MbChr 1: 165.59 – 165.6 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein CREG1 (ćelijski represor E1A-stimuliranih gena 1) jest protein koji je kod ljudi kodiran genom CREG1 sa hromosoma 1.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 220 aminokiselina, a molekulska težina 24.075 Da.[7]

1020304050
MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLP
PREDAARVARFVTHVSDWGALATISTLEAVRGRPFADVLSLSDGPPGAGS
GVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGFDPQSPLCVHI
MLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVL
DYFGGPKIVTPEEYYNVTVQ

Funkcija

Protein adenovirusa E1A istovremeno aktivira i potiskuje ekspresiju gena, kako bi promovirao ćelijsku proliferaciju i inhibirao diferencijaciju. Protein kodiran ovim genom antagonizira transkripcijsku aktivaciju i ćelijsku transformaciju pomoću E1A. Ovaj protein dijeli ograničenu sličnost sekvence sa E1A i vezuje se za opći transkripcijski faktor TBP i tumorski supresor pRb in vitro. Ovaj gen može doprinijeti transkripcijskoj kontroli rasta i ćelijske diferencijacije.[6]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000143162 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000040713 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Veal E, Eisenstein M, Tseng ZH, Gill G (Sep 1998). "A Cellular Repressor of E1A-Stimulated Genes That Inhibits Activation by E2F". Mol Cell Biol. 18 (9): 5032–41. doi:10.1128/mcb.18.9.5032. PMC 109088. PMID 9710587.
  6. ^ a b "Entrez Gene: CREG1 cellular repressor of E1A-stimulated genes 1".
  7. ^ "UniProt, O75629" (jezik: en.). Pristupljeno 9. 12. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura

Vanjski linkovi

Read other articles:

This article is about the Lebanese village in Aley. For the Lebanese village in Keserwan, see Aramoun, Keserwan. Village in Mount Lebanon Governorate, LebanonAramoun, Aley عرمونVillageAramoun, AleyCoordinates: 33°45′35″N 35°31′15″E / 33.75972°N 35.52083°E / 33.75972; 35.52083Country LebanonGovernorateMount Lebanon GovernorateDistrictAley DistrictArea[1] • Total11.68 km2 (4.51 sq mi)Elevation[1]500 m ...

 

Kozi Wierch Höhe 2291 m n.p.m. Lage Polen Gebirge Hohe Tatra, Karpaten Koordinaten 49° 13′ 6″ N, 20° 1′ 43″ O49.21833320.0286112291Koordinaten: 49° 13′ 6″ N, 20° 1′ 43″ O Kozi Wierch (Kleinpolen) Erstbesteigung 1867 durch Eugene Janota, Maciej Sieczka Besonderheiten höchster Berg, der sich ganz in Polen befindet f6 Der Kozi Wierch (deutsch: Gemsenberg) ist ein Berg in der Hohen Tatra mit einer Höhe vo...

 

Untuk pemilihan sebelumnya, lihat Pemilihan umum Britania Raya 2017. Pemilihan umum Britania Raya 20192017Selanjutnya12 Desember 2019← Anggota sekarangAnggota terpilih →650 kursi di Dewan Rakyat326 kursi untuk meraih status mayoritasJajak pendapat Kehadiran pemilih67,3% (1,6%)Kandidat   Partai pertama Partai kedua   Ketua Boris Johnson Jeremy Corbyn Partai Konservatif Buruh Ketua sejak 24 Juli 2019 12 September 2015 Kursi ketua Uxbridge dan Ruisl...

تيتانيكTitanic (بالإنجليزية) معلومات عامةالصنف الفني دراماتاريخ الصدور 1953مدة العرض 98 دقيقةاللغة الأصلية الإنجليزيةالعرض أبيض وأسود البلد الولايات المتحدةالجوائز  جائزة الأوسكار لأفضل كتابة سيناريو أصلي (1952)منحت لـ تشارلز براكيت، ‏Walter Reisch (en) ، ‏ريتشارد إل. برين الطاقمالم

 

1994 song by Elvis Costello 13 Steps Lead DownSingle by Elvis Costellofrom the album Brutal Youth B-sideDo You Know What I'm Saying?Released18 April 1994[1]Genre New wave punk rock LabelWarner Bros.Songwriter(s)Elvis CostelloProducer(s)Mitchell FroomElvis Costello singles chronology Sulky Girl (1994) 13 Steps Lead Down (1994) You Tripped at Every Step (1994) 13 Steps Lead Down is a song written and performed by new wave musician Elvis Costello that was first released on his 1994 album...

 

معركة معلولا جزء من الحرب الأهلية السورية منظر لمعلولا معلومات عامة التاريخ 4-15 سبتمبر 2013 الموقع معلولا، سوريا33°50′00″N 36°33′00″E / 33.833333333333°N 36.55°E / 33.833333333333; 36.55  النتيجة انتصار الجيش السوري[1][2] الجيش السوري يعيد السيطرة على معلولا[1][3] استمرار ت

Acto de Fe presidido por Santo Domingo de Guzmán Año h. 1495Autor Pedro BerrugueteTécnica Mixta sobre tablaEstilo RenacimientoTamaño 154 cm × 92 cmLocalización Museo del Prado, Madrid, España EspañaPaís de origen España[editar datos en Wikidata] El Acto de Fe presidido por Santo Domingo de Guzmán es un cuadro del pintor renacentista español Pedro Berruguete (ca. 1450-1504). Descripción Data de aproximadamente 1495 y está realizado en técnica mixta sobre tabla. Mi...

 

En el escudo de la ciudad de Budapest se han reunido las armas de las antiguas ciudades de Buda y de Pest. De la unión de estas dos ciudades, realizada en 1873, surgió la actual Budapest. Los elementos del escudo figuran sobre un campo de color rojo (blasonado de gules) dividido en dos partes por una franja blanca, horizontal y de forma ondulada, pieza conocida en heráldica como divisa que simboliza el río Danubio. En la parte superior figuran las armas de Pest, que consistieron en un cas...

 

This article is part of a series on thePolitics of the People's Republic of Bangladesh Constitution Amendments Law of Bangladesh Human rights Article 70 Judicial review Government President: Mohammed Shahabuddin Prime Minister: Sheikh Hasina Cabinet: Hasina IV Taxation Agencies Civil Service Local governments Parliament Speaker: Shirin Sharmin Chaudhury Leader of the House: Sheikh Hasina Leader of the Opposition: Rowshan Ershad Judiciary Supreme Court: Appellate Division High Court Division D...

Alstom Prima II on display at InnoTrans 2014 in Berlin Prima is a family of railway diesel and electric locomotives built by Alstom. During the late 1990s, manufacture of the type had commenced; by 2008, Alstom had reportedly sold 1,750 Prima locomotives.[citation needed] In 2009, the second generation Prima II was launched.[1] During 2013, the Prima H3 diesel/battery hybrid locomotive was launched. First generation This section needs expansion. You can help by adding to it. (...

 

This article does not cite any sources. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Efpalinos Tunnel – news · newspapers · books · scholar · JSTOR (April 2016) (Learn how and when to remove this template message) This article is about the modern motorway tunnel. For the ancient tunnel on Samos, see Tunnel of Eupalinos. Efpalinos TunnelOverviewLocationWest Attic...

 

Cartoon character Fictional character Koko the ClownKoko the Clown in KoKo's Showtime (1924)First appearanceExperiment No. 1 (1918)Created byMax Fleischer, Dave FleischerVoiced byGus Wickie (1933)Cab Calloway (1933)Larry Storch (1960-1961) Koko the Clown is an animated cartoon character created by Max Fleischer. He first appeared as the main protagonist in Out of the Inkwell (1918–1929), a major animated series of the silent era. Throughout the series, he goes on many adventures with his ca...

For the communication satellite experiment, see Project Echo. The Echo ProjectGenreJam bands, Alternative rock, Hip hop, jazz, americana, bluegrass, country, folk, gospel, reggae, electronicDatesOctoberLocation(s)Fairburn, Georgia, USYears active2007Founded byNicolas BouckaertWebsiteFormer official website, now defunct The Echo Project was a three-day music festival held from October 12–14, 2007 in Fairburn, GA. The event was founded by Nicolas Bouckaert and held on 350+ acres of Bouckaert ...

 

CalShip yard in 1944 Motorized hoisting truck used in moving scaffolding timbers around the shipyard, 1942. Calship fitting out its first Victory ships, c. early 1944 California Shipbuilding Corporation built 467 Liberty and Victory ships during World War II, including Haskell-class attack transports. California Shipbuilding Corporation was often referred to as Calship.[1] History In 1916 the California Shipbuilding Company built a few submarines in the Craig Shipbuilding Company yard...

 

2009 Copa Libertadores FemeninaTournament detailsHost countryBrazilDates3–18 October[1]Teams10 (from 10 associations)Venue(s)4 (in 3 host cities)Final positionsChampions SantosRunners-up Universidad AutónomaThird place Formas ÍntimasFourth place EvertonTournament statisticsMatches played24Goals scored121 (5.04 per match)Top scorer(s) Cristiane (15 goals)Best player(s) Marta2010 → International football competition The 2009 Copa Libertadores de Fútbol Fem...

This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article's tone or style may not reflect the encyclopedic tone used on Wikipedia. See Wikipedia's guide to writing better articles for suggestions. (October 2012) (Learn how and when to remove this template message) This article needs additional citations for verification. Please help improve this article by adding citations to reliable ...

 

Voc-tech public high school in Middletown, Delaware, United StatesSt. Georges Technical High SchoolAddress555 Hyett's Corner RdMiddletown, Delaware 19709United StatesCoordinates39°31′42″N 75°40′00″W / 39.5282°N 75.6668°W / 39.5282; -75.6668InformationTypeVoc-tech public high schoolEstablished2008 (15 years ago) (2008)School districtNew Castle County Vocational-Technical School DistrictCEEB code080096PrincipalChad Harrison (2021—present)Facul...

 

Sandstone statue of the Shalabhanjika Yakshi Sanchi Yaskshi FigureBracket figure from Sanchi on display at the British MuseumMaterialSandstoneSize65 cm HighCreated1st Century ADPresent locationBritish Museum, LondonRegistration1842,1210.1 The Sanchi Yakshi Figure is a sandstone statue of the Shalabhanjika Yakshi from the ancient Buddhist site of Sanchi in the state of Madhya Pradesh, India. One of the earliest Buddhist sculptures from the Indian subcontinent, it has been part of the British M...

Post-Roman British and Irish style of art This page (folio 292r) of the Book of Kells contains the lavishly decorated text that opens the Gospel of John. David from the Durham Cassiodorus, early 8th century (?), Jarrow[1] Insular art, also known as Hiberno-Saxon art, was produced in the post-Roman era of Great Britain and Ireland. The term derives from insula, the Latin term for island; in this period Britain and Ireland shared a largely common style different from that of the rest of...

 

Species of rodent Mo's spiny rat Conservation status Least Concern (IUCN 3.1)[1] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Mammalia Order: Rodentia Family: Muridae Genus: Maxomys Species: M. moi Binomial name Maxomys moi(Robinson & Kloss, 1922) Mo's spiny rat (Maxomys moi) is a species of rodent in the family Muridae. It is found in Laos and Vietnam. References ^ Laginha Pinto Correia, D. (2016). Maxomys moi. IUCN Red List of T...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!