Read other articles:

Марколь-лез-ОMarcols-les-Eaux Країна  Франція Регіон Овернь-Рона-Альпи  Департамент Ардеш  Округ Прива Кантон Сен-П'єррвіль Код INSEE 07149 Поштові індекси 07190 Координати 44°48′54″ пн. ш. 4°24′01″ сх. д.H G O Висота 671 - 1345 м.н.р.м. Площа 16 км² Населення 279 (01-2020[1]) Густота 20,5

Kanada  Todd Bertuzzi Geburtsdatum 2. Februar 1975 Geburtsort Greater Sudbury, Ontario, Kanada Größe 193 cm Gewicht 105 kg Position Rechter Flügel Nummer #44 Schusshand Links Draft NHL Entry Draft 1993, 1. Runde, 23. PositionNew York Islanders Karrierestationen 1991–1995 Guelph Storm 1995–1998 New York Islanders 1998–2006 Vancouver Canucks 2006–2007 Florida Panthers 2007 Detroit Red Wings 2007–2008 Anaheim Ducks 2008–2009 Calgary Flames 2009–2014 Detroit Red Wings T...

1986 single by Elvis Costello and the AttractionsI Want YouSingle by Elvis Costello and the Attractionsfrom the album Blood & Chocolate B-sideI Hope You're Happy NowReleasedNovember 1986 (November 1986)RecordedMarch–May 1986GenreNew waveLength6:45LabelImpSongwriter(s)Elvis CostelloProducer(s) Nick Lowe Colin Fairley Elvis Costello and the Attractions singles chronology Tokyo Storm Warning (1986) I Want You (1986) Blue Chair (1987) I Want You is a song written by Elvis Costello and ...

Islamic mosque in Bradford, Yorkshire, England The Mosque The Bradford Grand Mosque, or Al-Jamia Suffa-Tul-Islam Grand Mosque, is the largest mosque in Bradford, West Yorkshire, England.[1][2] It was founded in 1983,[3] building began in 2002 and it opened in 2012 or 2014.[4][5] It can house 8,000 worshippers and is one of the largest mosques in the United Kingdom.[1][4] The mosque was built on a filled in railway cutting which was part ...

الألعاب الآسيوية الشتوية 2029 البلد السعودية  المدينة المضيفة تروجينا  التاريخ 2029  المكان تروجينا  الرياضة رياضة شتوية  الألعاب الآسيوية الشتوية 2017    تعديل مصدري - تعديل   الألعاب الآسيوية الشتوية 2029 (تروجينا 2029) هي النسخة التاسعة من دورة الألعاب الآسيوي...

Sporting event delegationLibya at the2000 Summer OlympicsIOC codeLBANOCLibyan Olympic CommitteeWebsiteolympic.ly (in Arabic)in SydneyCompetitors3 in 3 sportsFlag bearer Nizar Mohamed NaeeliMedals Gold 0 Silver 0 Bronze 0 Total 0 Summer Olympics appearances (overview)196419681972–1976198019841988199219962000200420082012201620202024 Libya competed at the 2000 Summer Olympics in Sydney, Australia. The country's participation in Sydney marked its sixth appearance at a Summer Olympics ...

Natural gum consisting of the dried sap of Astragalus species Astragalus gummifer A dish of Tragacanth Tragacanth is a natural gum obtained from the dried sap of several species of Middle Eastern legumes of the genus Astragalus, including A. adscendens, A. gummifer,[1] A. brachycalyx,[2][3] and A. tragacantha. Some of these species are known collectively under the common names goat's thorn and locoweed. The gum is sometimes called Shiraz gum, shiraz, gum elect or gum d...

Motor vehicle Iveco N/NC/T/TurboIveco 160-23OverviewManufacturerFiat V.I./IvecoAlso calledFiat 170/190Production1975-1990AssemblyTorino, Italy (Fiat, Iveco)Ulm, Germany (Magirus-Deutz, Iveco)Trappes, France (UNIC, Iveco)Body and chassisClassMedium-duty truckHeavy-duty truckChronologyPredecessorFiat 619SuccessorIveco TurbostarIveco TurboTech The Iveco T-series is a medium to heavy-duty truck model produced by the Italian manufacturer Iveco, although it used the squared-off H-series cab or...

Season of television series ShamelessSeason 1DVD CoverStarring William H. Macy Emmy Rossum Justin Chatwin Ethan Cutkosky Shanola Hampton Steve Howey Emma Kenney Cameron Monaghan Jeremy Allen White Laura Slade Wiggins Joan Cusack Country of originUnited StatesNo. of episodes12ReleaseOriginal networkShowtimeOriginal releaseJanuary 9 (2011-01-09) –March 27, 2011 (2011-03-27)Season chronologyNext →Season 2List of episodes The first season of Shameless, an American comedy-d...

Leontius served as Greek Patriarch of Alexandria between 1052 and 1059. References Leontius (1052–1059). Official web site of the Greek Orthodox Patriarchate of Alexandria and All Africa. Retrieved 2011-02-07. Eastern Orthodox Church titles Preceded byGeorge II Greek Patriarch of Alexandria 1052–1059 Succeeded byAlexander II vtePatriarchs of AlexandriaPatriarchs prior to theChalcedonian schism(43–451) Mark I the Evangelist (founder) Anianus Avilius Kedronos Primus Justus Eumen...

Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...

1917 film The Devil-StoneLobby posterDirected byCecil B. DeMilleWritten byBeatrice deMilleJeanie MacPhersonLeighton OsmunProduced byJesse L. LaskyCecil B. DeMilleStarringGeraldine FarrarWallace ReidHobart BosworthTully MarshallCinematographyAlvin WyckoffEdited byCecil B. DeMilleProductioncompanyFamous Players–Lasky/ArtcraftDistributed byParamount PicturesRelease date December 16, 1917 (1917-12-16) Running time60 minutesCountryUnited StatesLanguageSilent (English intertitles) ...

TPMTAvailable structuresPDBOrtholog search: PDBe RCSB List of PDB id codes2BZG, 2H11IdentifiersAliasesTPMT, entrez:7172, TPMTD, thiopurine S-methyltransferaseExternal IDsOMIM: 187680 MGI: 98812 HomoloGene: 313 GeneCards: TPMT Gene location (Human)Chr.Chromosome 6 (human)[1]Band6p22.3Start18,128,311 bp[1]End18,155,077 bp[1]Gene location (Mouse)Chr.Chromosome 13 (mouse)[2]Band13 A5|13 24.5 cMStart47,175,958 bp[2]End47,198,213 bp[2]RNA express...

Pokémon the Movie: Genesect and the Legend Awakened Áp phích phim tại Nhật BảnTiếng Nhật劇場版ポケットモンスター ベストウイッシュ 神速のゲノセクト ミュウツー覚醒HepburnGekijōban Poketto Monsutā Besuto Uisshu! Shinsoku no Genosekuto: Myūtsū KakuseiDịch nghĩaPocket Monsters Best Wishes! The Movie: ExtremeSpeed Genesect: Mewtwo Awakens Đạo diễnKunihiko YuyamaSản xuấtTakemoto MoriChoji YoshikawaYukio KawasakiJunya OkamotoKoichi Kawas...

Electoral constituency in Oshana region, Namibia Uuvudhiya constituency (red) in the Oshana Region (yellow) Uuvudhiya Constituency is an electoral constituency in the Oshana Region of Namibia. It has 4,357 inhabitants,[1] its district capital is the settlement of Uuvudhiya. The constituency had 2,869 registered voters as of 2004.[2] Geography The constituency is by far the largest in Oshana region. It covers an area of 5,819 km2 (2,247 sq mi) and is part of the ...

Scotch Old CollegiansNamesFull nameScotch Old Collegians Football Club2021 seasonAfter finalsDNQHome-and-away season9thLeading goalkickerDaniel Cahill ( goals)Best and fairestTim ChampionClub detailsFounded1929; 94 years ago (1929)Colours  blue   goldCompetitionSouth Australian AmateurCoachMatthew KluzekCaptain(s)to be announcedGround(s)Prince of Wales Oval, Scotch CollegeUniforms Home Away Other informationOfficial websitescotchoc.com.au/football The Scotch Old Co...

KottoorPrimateCatholicos of the EastHeadquartersKottayam, KeralaTerritoryIndiaFounderKottoor family 5th centuryIndependenceUnder Kolenchery Church, St Peter's and St Paul's Orthodox Church,RecognitionOriental Orthodox Kottoor Church or Kottoor St. George Orthodox Syrian Church is an ancient chapel of Kolenchery Church. It is situated 0.5 km south of Kolenchery town, towards Karukappilly road and Muvattupuzha river. This Church is considered as the oldest of all structures founded in Kera...

1995 novel by Patrick O'Brian This article is about the seventeenth novel in Patrick O'Brian's Aubrey-Maturin series. For the C.S. Forester Hornblower novel, see The Commodore. The Commodore First edition coverAuthorPatrick O'BrianCover artistGeoff HuntCountryUnited KingdomLanguageEnglishSeriesAubrey-Maturin seriesGenreHistorical novelPublisherHarperCollins (UK)Publication date1994Media typePrint (Hardback & Paperback) & Audio Book (Compact audio cassette, Compact Disc)Pages...

This article relies excessively on references to primary sources. Please improve this article by adding secondary or tertiary sources. Find sources: Sensor node – news · newspapers · books · scholar · JSTOR (February 2015) (Learn how and when to remove this template message) The typical architecture of the sensor node. A sensor node (also known as a mote in North America), consists of an individual node from a sensor network that is capable of performi...

American journalist (1945-2006) George Crile IIICrile in AfghanistanBornGeorge Washington Crile IIIMarch 5, 1945Cleveland, Ohio, U.S.DiedMay 15, 2006 (2006-05-16) (aged 61)Manhattan, New York, U.S.EducationTrinity CollegeGeorgetown UniversityOccupations Journalist producer TelevisionCBS News60 Minutes60 Minutes IIRelativesRip Esselstyn (nephew)AwardsEmmy AwardPeabody AwardEdward R. Murrow AwardAmerican Film Festival Blue Ribbon George Washington Crile III (March 5, 1945 – May ...