Pertempuran Numfor
|
Read other articles:
View of the monastery. The Monastery of Santa Maria de Santes Creus, (Catalan: Reial Monestir de Santa Maria de Santes Creus) is a former Cistercian monastery in the municipality of Aiguamúrcia, Catalonia, Spain.[1] The abbey was erected in the 12th century, in today's municipality of Aiguamúrcia, in the village of Santes Creus, in the province of Tarragona (Catalonia). However, it was in the thirteenth century when Peter III of Aragon expressed his desire to be buried in the monast...
تم العثور على تعويذة شارلمان على جسده عند فتح قبره أحد طلاسم كتاب السحر غرايمور طلسم وجمعها طلاسم (تسمى في اللاتينية amuletum ولفظها في اليونانية قريب للفظ العربي، ومن العربية انتقل اللفظ إلى اللغة الإنجليزية (talisman) هي خطوط وكتابات لا تحتوي على معنى واضح ومفهوم يستخدمها السحرة...
?Phocoena dioptrica Розміри порівняно з людиною Охоронний статус Даних недостатньо (МСОП 3.1) Біологічна класифікація Царство: Тварини (Animalia) Тип: Хордові (Chordata) Підтип: Черепні (Craniata) Інфратип: Хребетні (Vertebrata) Клас: Ссавці (Mammalia) Ряд: Китоподібні (Cetacea) Інфраряд: Зубаті кити (Odontoceti) ...
?Чорна котяча акула великоноса Охоронний статус Даних недостатньо (МСОП 3.1) Біологічна класифікація Домен: Ядерні (Eukaryota) Царство: Тварини (Animalia) Підцарство: Справжні багатоклітинні (Eumetazoa) Тип: Хордові (Chordata) Підтип: Черепні (Craniata) Надклас: Щелепні (Gnathostomata) Клас:
Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada November 2022. Artikel ini membutuhkan penyuntingan lebih lanjut mengenai tata bahasa, gaya penulisan, hubungan antarparagraf, nada penulisan, atau ejaan. Anda dapat membantu untuk menyuntingnya. Gaya atau nada penulisan artikel ini tidak mengikuti gaya dan nada pen...
Singaporean actress (born 1995) This biography of a living person needs additional citations for verification. Please help by adding reliable sources. Contentious material about living persons that is unsourced or poorly sourced must be removed immediately from the article and its talk page, especially if potentially libelous.Find sources: Kimberly Chia – news · newspapers · books · scholar · JSTOR (July 2021) (Learn how and when to remove this templat...
Public university in Maryville, Missouri, US Northwest Missouri State UniversityFormer namesFifth District Normal School (1905–1919)Northwest Missouri State Teacher's College (1919–1949)Northwest Missouri State College (1949–1972)TypePublic universityEstablished1905; 118 years ago (1905)Endowment$27.26 million (2017)[1]PresidentLance TatumProvostJamie HooymanAcademic staff292 (Fall 2017)[2]Students8,505 (Fall 2022)[2]Undergraduates5,324 (Fall 20...
Indian State Government Government of JharkhandSeat of GovernmentRanchiWebsitehttps://www.jharkhand.gov.in/Legislative branchAssemblyJharkhand Vidhan SabhaSpeakerRabindra Nath MahatoMembers in Assembly81Executive branchGovernorC.P. RadhakrishnanChief MinisterHemant SorenChief SecretarySukhdeo Singh, IASJudiciaryHigh CourtJharkhand High CourtChief JusticeSanjaya Kumar Mishra The Government of Jharkhand also known as the State Government of Jharkhand, or locally as State Government, is the supr...
This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Amor Louco – news · newspapers · books · scholar · JSTOR (August 2013) (Learn how and when to remove this template message) 1990 studio album by FelliniAmor LoucoStudio album by FelliniReleasedFebruary 15, 1990 (re-released in 2001)Recorded1989GenrePost...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
DDR-Oberliga 1954/1955 1953/1954 1955 Szczegóły Państwo NRD Liczba meczów 182 Liczba bramek 614 Zwycięzca BSG Turbine Erfurt Król strzelców Willy Tröger (22) Sezon 1954/1955 był szóstym sezonem DDR-Oberligi, stanowiącej pierwszy poziom rozgrywek w NRD. Tabela Miejsce Klub M Z R P Bramki Br/m Punkty 1. SC Turbine Erfurt (M) 26 13 8 5 58:25 2,32 34-18 2. SC Wismut Karl-Marx-Stadt 26 13 7 6 62:38 1,63 33-19 3. SC Rotation Leipzig 26 10 10 6 58:47 1,23 30-22 4. Einheit Drezno 26 ...
TV channel in the Philippines For other uses, see Viva (disambiguation). This article uses bare URLs, which are uninformative and vulnerable to link rot. Please consider converting them to full citations to ensure the article remains verifiable and maintains a consistent citation style. Several templates and tools are available to assist in formatting, such as reFill (documentation) and Citation bot (documentation). (August 2022) (Learn how and when to remove this template message) Television...
For the EP by 8in8, see Nighty Night (EP). British TV series or programme Nighty NightGenreSitcomDark comedyComedy-dramaSurreal humourHorrorCreated byJulia DavisWritten by Julia Davis Jane Stanness Mark Gatiss Ruth Jones Marc Wootton Directed byTony DowDewi HumpfreysStarringJulia Davis Rebecca FrontAngus DeaytonKevin EldonRuth JonesMark GatissFelicity MontaguMichael Fenton StevensCountry of originUnited KingdomNo. of series2No. of episodes12ProductionExecutive producersHenry NormalSteve ...
Music genre and scene This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article's tone or style may not reflect the encyclopedic tone used on Wikipedia. See Wikipedia's guide to writing better articles for suggestions. (February 2018) (Learn how and when to remove this template message) The neutrality of this article is disputed. Relevant discussion may be found on the talk page. Pleas...
This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) This article's lead section may not adequately summarize its contents. Please help improve the lead by writing an accessible overview. (March 2020) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources:&...
American banking and financial services company Not to be confused with Citigroup or CITIC Group. CIT GroupCompany logo since 2018TypeSubsidiaryIndustryBankingFinancial servicesFounded1908; 115 years ago (1908) in St. Louis, MissouriFounderHenry IttlesonHeadquarters11 West 42nd Street, New York, New York, USAArea servedNorth AmericaKey peopleEllen Alemany(Chairwoman & CEO)John Fawcett(CFO)Robert Rubino(President of CIT Bank)ProductsCommercial bankingRetail bankingAsset-b...
7-Chlorokynurenic acid Names Preferred IUPAC name 7-Chloro-4-oxo-1,4-dihydroquinoline-2-carboxylic acid Other names 7-chlorokynurenate; 7-CTKA Identifiers CAS Number 18000-24-3 Y 3D model (JSmol) Interactive image ChemSpider 1813 ECHA InfoCard 100.038.088 PubChem CID 1884 UNII S7936QON2K Y CompTox Dashboard (EPA) DTXSID7042568 SMILES C1=CC2=C(C=C1Cl)NC(=CC2=O)C(=O)O Properties Chemical formula C10H6Cl1N1O3 Molar mass 223.61254 g/mol Except where otherwise noted, d...
Photography and film term referring to framing a shot For other uses, see Close up (disambiguation). This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Close-up – news · newspapers · books · scholar · JSTOR (May 2016) (Learn how and when to remove this template message) Mexican actress Dolores del Río in a clo...
Indian politician Pannyan RaveendranSecretary of the Communist Party of India Kerala State CouncilIn office10 April 2012 (2012-04-10) – 2 March 2015 (2015-03-02)Preceded byC. K. ChandrappanSucceeded byKanam RajendranMember of Parliament, Lok SabhaIn office2005 (2005)–2009 (2009)Preceded byP. K. Vasudevan NairSucceeded byShashi TharoorConstituencyThiruvananthapuram Personal detailsBorn (1945-12-22) 22 December 1945 (age 77)Kannur, Keral...
Cinema of theUnited Kingdom List of British films British horror 1888–1919 1920s 1920 1921 1922 1923 19241925 1926 1927 1928 1929 1930s 1930 1931 1932 1933 19341935 1936 1937 1938 1939 1940s 1940 1941 1942 1943 19441945 1946 1947 1948 1949 1950s 1950 1951 1952 1953 19541955 1956 1957 1958 1959 1960s 1960 1961 1962 1963 19641965 1966 1967 1968 1969 1970s 1970 1971 1972 1973 19741975 1976 1977 1978 1979 1980s 1980 1981 1982 1983 19841985 1986 1987 1988 1989 1990s 1990 1991 1992 1993 19941995 ...