奇異博士 (電影)
|
Read other articles:
North Florida OspreysUniversityUniversity of North FloridaConferenceASUN Conference (primary) CCSA (women's swimming & diving)NCAADivision IAthletic directorNick MorrowLocationJacksonville, FloridaVarsity teams18 (7 men's, 11 women's)Basketball arenaUNF ArenaBaseball stadiumHarmon StadiumSoftball stadiumUNF Softball ComplexSoccer stadiumHodges StadiumAquatics centerUNF Competition Pool ComplexTennis venueUNF Tennis ComplexOther venuesThe Cooper Beach Volleyball Complex UNF Hayt Golf Cente...
Halaman artikel ini diterjemahkan, sebagian atau seluruhnya, dari halaman di en.wikipedia yang berjudul (Tolong cantumkan nama artikel sumber terjemahan). Lihat pula sejarah suntingan halaman aslinya untuk melihat daftar penulisnya. Artikel ini tidak memiliki referensi atau sumber tepercaya sehingga isinya tidak bisa dipastikan. Tolong bantu perbaiki artikel ini dengan menambahkan referensi yang layak. Tulisan tanpa sumber dapat dipertanyakan dan dihapus sewaktu-waktu.Cari sumber: Victor...
هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أكتوبر 2017) كاثرين تيريزا كوكسون معلومات شخصية مكان الميلاد مقاطعة ويكلاو الحياة العملية المهنة رسام نباتي تعديل مصدري - تعديل كاثرين تيريزا كوكسون (بالإنجلي
Association football match Football match2022 EFL League Two play-off FinalWembley Stadium in London hosted the final. Mansfield Town Port Vale 0 3 Date28 May 2022 (2022-05-28)VenueWembley Stadium, LondonMan of the MatchJames WilsonRefereeJarred GillettAttendance37,303← 2021 2023 → The 2022 EFL League Two play-off Final was an association football match which was played on 28 May 2022 at Wembley Stadium, London, to determine the fourth and final team to gain promoti...
Mixture of organic matter, minerals, gases, liquids, and organisms that together support life For other uses, see Soil (disambiguation). Surface-water-gley developed in glacial till in Northern Ireland Soil, also commonly referred to as earth or dirt, is a mixture of organic matter, minerals, gases, liquids, and organisms that together support the life of plants and soil organisms. Some scientific definitions distinguish dirt from soil by restricting the former term specifically to displaced ...
2015 autobiography by Jimmy Carter For 1962 memoir A Full Life by Sir Brian Horrocks, see Brian Horrocks. A Full Life: Reflections at 90 AuthorJimmy CarterCountryUnited StatesLanguageEnglishSubjectAutobiographyPublished2015 (Simon & Schuster)Media typePrint (hardcover), Audiobook (Audio CD)Pages272ISBN978-1-5011-1563-9 A Full Life: Reflections at 90 is a memoir written by Jimmy Carter, the 39th President of the United States, released on July 7, 2015. The book is a collection of refl...
Species of butterfly Yellow-edged giant owl Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Arthropoda Class: Insecta Order: Lepidoptera Family: Nymphalidae Genus: Caligo Species: C. atreus Binomial name Caligo atreusKollar, 1850 Caligo atreus, the yellow-edged giant owl, is a butterfly of the family Nymphalidae. The species can be found from Mexico to Peru.[1] Upperside The wingspan is 140–160 mm. The larvae feed on Musa and Heliconia species and can...
1747 play The Suspicious HusbandDavid Garrick and Hannah Pritchard in The Suspicious HusbandWritten byBenjamin HoadlyDate premiered12 February 1747Place premieredCovent Garden TheatreOriginal languageEnglishGenreComedy The Suspicious Husband is a 1747 comedy play by the British writer Benjamin Hoadly.[1] It premiered at the Covent Garden Theatre in February 1747. The original cast included David Garrick as Ranger, Roger Bridgewater as Strictland, Lacy Ryan as Frankly, William Havard a...
Protein-coding gene in the species Homo sapiens EIF4G1Available structuresPDBOrtholog search: PDBe RCSB List of PDB id codes1LJ2, 1UG3, 2W97, 4AZA, 4F02IdentifiersAliasesEIF4G1, EIF-4G1, EIF4F, EIF4G, EIF4GI, P220, PARK18, Eukaryotic translation initiation factor 4 gamma, eukaryotic translation initiation factor 4 gamma 1External IDsOMIM: 600495 MGI: 2384784 HomoloGene: 110725 GeneCards: EIF4G1 Gene location (Human)Chr.Chromosome 3 (human)[1]Band3q27.1Start184,314,495 bp[1]End...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
2006 Indian filmParijathamDVD coverDirected byK. BhagyarajWritten byBhagyarajProduced byV. RavichandranStarringPrithvirajSaranya BhagyarajPrakash RajSeethaSarath BabuRojaCinematographyVenu NatrajA. VenkateshMusic byDharanProductioncompanyAascar Film Pvt. LtdRelease date 9 June 2006 (2006-06-09) CountryIndiaLanguageTamilBudget₹3 crore (US$380,000)[1] Parijatham is a 2006 Indian Tamil language romantic drama film directed by Bhagyaraj. The film stars Prithviraj and Sara...
Breed of cattle Pair of Madurese CattlesMadura cattle or Madurese cattle (Indonesian: Sapi madura) are a stable, inbred hybrid of Zebu and Banteng (Bos javanicus).[1][2] They originated from the island of Madura just northeast of Java, in Indonesia where the original cattle population was the wild Banteng, very similar to Balinese cattle. Sinhala cattle, a Zebu breed from Sri Lanka, were introduced more than 1500 years ago, and the crossbreeds between the two was found to be b...
Pour les articles homonymes, voir Navarre. Communauté forale de Navarre Comunidad Foral de Navarra (es)Nafarroako Foru Komunitatea (eu) Armoiries Drapeau de la Navarre Administration Pays Espagne Capitale Pampelune Statut d'autonomie 16 août 1982 Sièges au Parlement 5 députés5 (4 élus et 1 désigné) sénateurs Président María Chivite (PSOE) Pouvoir législatif Parlement de Navarre ISO 3166-2:ES ES-NC, ES-NA Démographie Gentilé Navarrais, NavarraiseNavarro, navarra (en espagnol)Nafa...
Notable war correspondents This is a dynamic list and may never be able to satisfy particular standards for completeness. You can help by adding missing items with reliable sources. 19th century Archibald Forbes Benjamin C. Truman Bennet Burleigh (1840–1914), Sudan (Omdurman), Boer War, Russo-Japanese War, Italo-Turkish war Charles Frederick Williams, British journalist. Ferdinando Petruccelli della Gattina, Expedition of the thousand, Second and Third Italian War of Independence, Paris Com...
Lukisan Tritunggal gaya Barok, karya Hendrick van Balen, 1620, Gereja Sint-Jacobskerk, Antwerpen Tritunggal sangat umum ditampilkan dalam seni rupa Kristen dengan penggambaran Roh Kudus dalam wujud burung merpati, sama seperti wujud penampakan Roh Kudus pada peristiwa Pembaptisan Kristus sebagaimana yang diriwayatkan di dalam Injil, dan nyaris selalu digambarkan dengan sayap-sayap terkembang. Meskipun demikian, adakalanya Tritunggal digambarkan dalam rupa tiga sosok antropomorfis.[1] ...
الرسم في العصر الذهبي الهولنديمعلومات عامةجزء من العصر الذهبي الهولنديالباروك (رسم)Dutch painting (en) مجال العمل رسم البلد جمهورية هولندا تاريخ البدء 1600 تاريخ الانتهاء 1699 تأثر ب كالفينيةالنهضة الإيطاليةكارافاجيو تعديل - تعديل مصدري - تعديل ويكي بيانات الرسم الهولندي في العصر ال...
Neighbourhood in Kolkata in West Bengal, IndiaKalighatNeighbourhood in Kolkata (Calcutta)KalighatLocation in KolkataCoordinates: 22°31′05″N 88°20′46″E / 22.518°N 88.346°E / 22.518; 88.346Country IndiaStateWest BengalCityKolkataDistrictKolkataMetro stationJatin Das Park and KalighatMunicipal CorporationKolkata Municipal CorporationKMC wards73, 83, 84, 87, 88Elevation36 ft (11 m)Time zoneUTC+5:30 (IST)PIN700 026Area code+91 33Lok Sabha constitu...
1984 Indian filmVaazhkaiPosterDirected byC. V. RajendranScreenplay byPanchu ArunachalamStory byMohan KumarProduced byChitra RaamuChitra LakshmananStarringSivaji GanesanAmbikaPandiyanCinematographyT. S. VinayagamEdited byChandran–MuthuMusic byIlaiyaraajaProductioncompanyGayathri FilmsDistributed byP. A. Art ProductionsRelease date 14 April 1984 (1984-04-14) CountryIndiaLanguageTamil Vaazhkai (pronounced [ʋaːɻkaɪ] transl. Life) is a 1984 Indian Tamil-language ...
United States legal case Not to be confused with Ex parte Milligan. Chief Justice Roger B. Taney issued the ruling in Ex parte Merryman. Ex parte Merryman, 17 F. Cas. 144 (C.C.D. Md. 1861) (No. 9487), was a controversial U.S. federal court case that arose out of the American Civil War.[1] It was a test of the authority of the President to suspend the privilege of the writ of habeas corpus under the Constitution's Suspension Clause, when Congress was in recess and theref...
Як-38 Штурмовики Як-38 на борту тяжёлого авианесущего крейсера «Новороссийск», 1984 год. Тип палубный штурмовик вертикального взлёта и посадки Разработчик ОКБ Яковлева Производитель Саратовский авиазавод Главный конструктор С. Г. Мордовин Первый полёт 22 сентября 1970 года[...