CEP85

CEP85
Ідентифікатори
Символи CEP85, CCDC21, centrosomal protein 85
Зовнішні ІД MGI: 1917262 HomoloGene: 11254 GeneCards: CEP85
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001281517
NM_001281518
NM_022778
NM_001319944
NM_144527
RefSeq (білок)
NP_001268446
NP_001268447
NP_001306873
NP_073615
NP_653110
Локус (UCSC) Хр. 1: 26.23 – 26.28 Mb Хр. 4: 134.13 – 134.19 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CEP85 (англ. Centrosomal protein 85) – білок, який кодується однойменним геном, розташованим у людей на 1-й хромосомі.[3] Довжина поліпептидного ланцюга білка становить 762 амінокислот, а молекулярна маса — 85 639[4].

Послідовність амінокислот
1020304050
MAMQEKYPTEGISHVTSPSSDVIQKGSSLGTEWQTPVISEPFRSRFSRCS
SVADSGDTAIGTSCSDIAEDFCSSSGSPPFQPIKSHVTIPTAHVMPSTLG
TSPAKPNSTPVGPSSSKLPLSGLAESVGMTRNGDLGAMKHSPGLSRDLMY
FSGATGENGIEQSWFPAVGHERQEEARKFDIPSMESTLNQSAMMETLYSD
PHHRVRFHNPRTSTSKELYRVLPEAKKAPGSGAVFERNGPHSNSSGVLPL
GLQPAPGLSKPLPSQVWQPSPDTWHPREQSCELSTCRQQLELIRLQMEQM
QLQNGAICHHPAAFGPSLPILEPAQWISILNSNEHLLKEKELLIDKQRKH
ISQLEQKVRESELQVHSALLGRPAPFGDVCLLRLQELQRENTFLRAQFAQ
KTEALSREKIDLEKKLSASEVEVQLIRESLKVALQKHSEEVKKQEERVKG
RDKHINNLKKKCQKESEQNREKQQRIETLERYLADLPTLEDHQKQSQQLK
DSELKSTELQEKVTELESLLEETQAICREKEIQLESLRQREAEFSSAGHS
LQDKQSVEETSGEGPEVEMESWQKRYDSLQKIVEKQQQKMDQLRSQVQSL
EQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQ
EHLRQAQPGSPPSPDTAQLALELHQELASCLQDLQAVCSIVTQRAQGHDP
NLSLLLGIHSAQHPETQLDLQKPDVIKRKLEEVQQLRRDIEDLRTTMSDR
YAQDMGENCVTQ

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як розходження хромосом, альтернативний сплайсинг. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004.  PMID 15489334 DOI:10.1101/gr.2596504

Примітки

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:25309 (англ.) . Архів оригіналу за 22 серпня 2017. Процитовано 18 вересня 2017.  [Архівовано 2017-08-22 у Wayback Machine.]
  4. UniProt, Q6P2H3 (англ.) . Архів оригіналу за 22 серпня 2017. Процитовано 18 вересня 2017. 

Див. також

Read other articles:

Este nombre sigue la onomástica coreana; el apellido es Lee. Donghae Donghae en septiembre de 2019.Información personalNombre de nacimiento Lee Dong-hae 이동해Otros nombres DonghaeNacimiento 15 de octubre de 1986 (37 años) Mokpo, Jeolla del Sur, Corea del SurMokpo (Corea del Sur) Nacionalidad SurcoreanaEducaciónEducado en Universidad Myongji Información profesionalOcupación Cantante, actor, bailarín, modelo, compositorAños activo 2005 – presenteSeudónimo DonghaeGénero...

 

زاورالسكيي (بالروسية: Зауральский)‏  تقسيم إداري البلد روسيا  إحداثيات 54°46′58″N 61°14′29″E / 54.782777777778°N 61.241388888889°E / 54.782777777778; 61.241388888889  السكان التعداد السكاني 7395 (1 يناير 2018)[1]  معلومات أخرى الرمز البريدي 456591  الرمز الهاتفي 35138  تعديل مصدري - تعديل...

 

  لمعانٍ أخرى، طالع بيكار (توضيح). حسين بيكار معلومات شخصية الميلاد 2 يناير 1913(1913-01-02)الإسكندرية  تاريخ الوفاة 16 نوفمبر 2002 (89 سنة) (العمر 89 سنة) مواطنة مصر  الحياة العملية المهنة رسام[1]،  ومصمم،  ورسام توضيحي[1]،  وموسيقي[1]،  وشاعر  اللغة الأم ال

Untuk kegunaan lain, lihat Kehidupan di Mars (disambiguasi). Mikroskop eletkron mendeteksi struktur yang mirip bakteri pada meteorit ALH84001. Ilmuwan sudah lama menspekulasikan mengenai kemungkinan adanya kehidupan di Mars karena kemiripan planet ini dengan Bumi. Masih menjadi pertanyakan apakah kehidupan eksis di Mars kini, atau pada masa lalu. NASA berencana untuk meluncurkan Astrobiology Field Laboratory tahun 2016, untuk membantu menjawab pertanyaan mengenai kehidupan di Mars. The Mars E...

 

Russian volleyball player Irina TebenikhinaPersonal informationFull nameIrina Viktorovna TebenikhinaBorn (1978-12-05) 5 December 1978 (age 44)Fargona, UzbekistanHeight1.89 m (6 ft 2 in) Honours Women's volleyball Representing  Russia Olympic Games 2004 Athens Team World Championship 1998 Japan Team FIVB World Cup 1999 Japan Team Irina Tebenikhina (born 5 December 1978, in Fergana) is a volleyball player from Russia, who represented her native country at the 2004 ...

 

  هذه المقالة عن المجلس الإسلامي البريطاني. لمعانٍ أخرى، طالع مجلس إسلامي (توضيح).   المجلس الإسلامي البريطاني المجلس الإسلامي البريطاني‌ البلد المملكة المتحدة  تاريخ التأسيس 1997  الرئيس زارا محمد  الأمين العام زارا محمد (–)  الموقع الرسمي الموقع الرسمي 

Flocourt Flocourt (Frankreich) Staat Frankreich Region Grand Est Département (Nr.) Moselle (57) Arrondissement Metz Kanton Faulquemont Gemeindeverband Sud Messin Koordinaten 48° 58′ N, 6° 25′ O48.9730555555566.4111111111111Koordinaten: 48° 58′ N, 6° 25′ O Höhe 226–273 m Fläche 4,53 km² Einwohner 117 (1. Januar 2020) Bevölkerungsdichte 26 Einw./km² Postleitzahl 57580 INSEE-Code 57220 Flocourt Vorlage:Infobox Gemeinde in...

 

Title of the head of state in various governments Part of the Politics series onExecutive government Head of state Monarch Supreme leader President President of the Council of State Government Head of government ChancellorChief executiveChief ministerFirst ministerPremierPrime ministerPresident of the Council of MinistersPresident of the government CabinetGovernment formationCabinet collective responsibility Ministry MinisterSecretary Other GovernorMayor Systems Monarchy (Constitutional) Repu...

 

Safety barrier used on the central reservation of motorways This article has multiple issues. Please help improve it or discuss these issues on the talk page. (Learn how and when to remove these template messages) The examples and perspective in this article may not represent a worldwide view of the subject. You may improve this article, discuss the issue on the talk page, or create a new article, as appropriate. (March 2018) (Learn how and when to remove this template message)This article ne...

[تعديل]  الحلف الأطلسي منظمة حلف شمال الأطلسي (بالإنجليزية: North Atlantic Treaty Organisation)‏ اختصاراً الناتو (بالإنجليزية: NATO)‏ هي منظمة تأسست عام 1949 بناءً على معاهدة شمال الأطلسي التي تم التوقيع عليها في واشنطن في 4 أبريل 1949. يوجد مقر قيادة الحلف في بروكسل عاصمة بلجيكا. وللحلف لغتان ...

 

Town in Kerala, IndiaChengala ChengalaTownThekkil Bridge, looking north towards ChengalaCoordinates: 12°30′31″N 75°03′21″E / 12.508710°N 75.055770°E / 12.508710; 75.055770Country IndiaStateKeralaDistrictKasaragodArea • Total9.07 km2 (3.50 sq mi)Population (2011) • Total15,588 • Density1,700/km2 (4,500/sq mi)Languages • OfficialMalayalam, EnglishTime zoneUTC+5:30 (IST)Vehicle regis...

 

1989 book by Stephen Jay Gould Wonderful Life Cover of the first editionAuthorStephen Jay GouldCountryUnited StatesLanguageEnglishSubjectsEvolutionary history of lifeBurgess ShalePublisherW. W. Norton & Co.Publication date1989Media typePrint (Hardcover and Paperback)Pages347 pp.ISBN0-393-02705-8OCLC18983518Dewey Decimal560/.9 19LC ClassQE770 .G67 1989Preceded byAn Urchin in the Storm Followed byBully for Brontosaurus  Wonderful Life: The Burgess Shale and the...

Maritime rescue device made of stiffened netting This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Jason's cradle – news · newspapers · books · scholar · JSTOR (August 2010) (Learn how and when to remove this template message) Box containing Jason's Cradle A Jason's cradle is a maritime rescue device. The devi...

 

This article is about a location in England. For the place in Tasmania, see Tasmanian Land Conservancy. Vale of Belvoir from near Ab Kettleby off the A606 The Vale of Belvoir (/ˈbiːvər/ ⓘ BEE-vər) covers adjacent areas of Leicestershire, Nottinghamshire and Lincolnshire, England. The name derives from the Norman-French for beautiful view and dates back to Norman times.[1] A panorama of the Vale of Belvoir Extent and geology A plate from Jones's Views (1819), showing Belvoir ...

 

هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (يناير 2022) إسماعيل عبد ال رزاق معلومات شخصية الميلاد 7 مارس 1989 (العمر 34 سنة)أكرا  الطول 1.81 م (5 قدم 11 بوصة) مركز اللعب وسط الجنسية غانا  مسيرة الشباب سنوات فري...

Municipality in Rhineland-Palatinate, GermanyWilgartswiesen Municipality Coat of armsLocation of Wilgartswiesen within Südwestpfalz district Wilgartswiesen Show map of GermanyWilgartswiesen Show map of Rhineland-PalatinateCoordinates: 49°13′N 7°53′E / 49.217°N 7.883°E / 49.217; 7.883CountryGermanyStateRhineland-PalatinateDistrictSüdwestpfalz Municipal assoc.HauensteinGovernment • Mayor (2019–24) Manfred Schoch[1]Area • To...

 

Russian pianist, conductor and composer For the Bengali-Assamese language Silôţi, see Sylheti language. In this name that follows Eastern Slavic naming conventions, the patronymic is Ilyich and the family name is Siloti. Siloti (left) with Tchaikovsky (right). Alexander Ilyich Siloti (also Ziloti, Russian: Алекса́ндр Ильи́ч Зило́ти, Aleksandr Iljič Ziloti, Ukrainian: Олександр Ілліч Зілоті;[1] 9 October 1863 – 8 December 1945) was a ...

 

Digital single-lens reflex camera Nikon D5100[1]Nikon D5100 with 18-55mm VR kit lensOverviewMakerNikonTypeDX-format Digital single-lens reflexReleasedApril 5, 2011LensLens mountNikon F-mountSensor/mediumSensor23.6 mm × 15.6 mm Nikon DX format RGB CMOS sensor, 1.5 × FOV crop, 4.78 µm pixel sizeSensor typeActive pixel sensorSensor sizeDX format (23.6 x 15.6 mm)Sensor makerSonyMaximum resolution4,928 × 3,264 (16.2 effective megapixels)Film speed100–6400 in 1/3 EV ste...

2009 song by T.I. featuring Justin Timberlake For other uses, see Dead and Gone (disambiguation). Dead and GoneSingle by T.I. featuring Justin Timberlakefrom the album Paper Trail ReleasedJanuary 12, 2009Recorded2008GenreHip hopLength4:59 (album version) 3:52 (radio edit)Label Grand Hustle Atlantic Songwriter(s) Clifford Harris, Jr. Justin Timberlake Robin Tadross Producer(s) Justin Timberlake Rob Knox T.I. singles chronology Ain't I (2008) Dead and Gone (2009) Day Dreaming (2009) Justin ...

 

Не следует путать с Московским гуманитарным университетом. В этой статье недостаточно критики, так как необходимо освещение с различных точек зрения. Статью нельзя назвать рекламной, но в ней слабо представлена критика. Пожалуйста, добавьте информацию из публикаций и д...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!