Read other articles:

1986 single by Concrete BlondeStill in HollywoodSingle by Concrete Blondefrom the album Concrete Blonde ReleasedDecember 1986Length3:42LabelI.R.S.Songwriter(s)Johnette NapolitanoProducer(s) Earle Mankey Concrete Blonde Concrete Blonde singles chronology Still in Hollywood (1986) True (1987) Still in Hollywood is the debut single by American alternative rock band Concrete Blonde, which was released in 1986 from their self-titled debut studio album. The song was written by Johnette Napolitano, ...

Ця стаття про озеро. Про річку див. Ялпуг (річка) та Ялпуг (значення). Ялпуг Південне узбережжя озераПівденне узбережжя озера 45°25′00″ пн. ш. 28°37′00″ сх. д. / 45.41667° пн. ш. 28.61667° сх. д. / 45.41667; 28.61667Координати: 45°25′00″ пн. ш. 28°37′00″ сх. ...

Columna de control en forma de W de un Boeing 737. Tenga en cuenta las lista de comprobación (checklist) en el medio. Una columna de control, es un dispositivo utilizado para pilotar algunos aviones de ala fija .[1]​ El piloto usa la columna de control para controlar la altitud del avión, generalmente tanto en cabeceo como en balanceo. Al girar se controlan los alerones y el eje longitudinal. El movimiento hacia delante y hacia atrás de la columna de control controla el elevador y el...

Distancing SociallyPoster rilis resmiSutradara Chris Blake Produser Chris Blake Milan Chakraborty Josh Moody Dave Moody (musisi) Ditulis oleh Chris Blake Skenario Chris Blake Pemeran Rory Scovel Jessika Van Alan Tudyk Melanie Chandra Sarah Levy Connor Paolo Andy Buckley Jim O'Heir Penata musikBryan ArataSinematograferJosh MoodyPerusahaanproduksiMonkeyRat ProductionsDistributorCinedigmTanggal rilis 5 Oktober 2021 (2021-10-05) Durasi96 menitNegara Amerika Serikat Bahasa Inggris Dista...

Serbian heraldryDouble-headed eagle of Nemanjić dynasty Heraldic traditionByzantineGoverning bodySerbian Heraldry Society Serbian heraldry involves the study and use of coats of arms and other heraldic insignia in the country of Serbia or by Serbs. The Serbian government is the armiger in Serbia, exercising that right under the advice of the Serbian Heraldry Society (Serbian Cyrillic: Српско хералдичко друштво, romanized: Srpsko heraldičko društvo), a learn...

Late 8th-century–1215 Iranian dynasty from Ghor, modern Afghanistan Ghurid dynastybefore 786–12151203KHWARAZMIANEMPIREKIPCHAKSABBASIDCALIPHATEZENGIDSYADAVASPARA-MARASCHANDELASQOCHOQARA KHITAIKARA-KHANIDS ◁ ▷ Map of Ghurid territory, before the assassination of Muhammad of Ghor.[1][2][3] In the west, Ghurid territory extended to Nishapur and Merv,[4][5] while Ghurid troops reached as far as Gorgan on the shores of the Caspian Sea.[6][...

Genus of turtles AcherontemysTemporal range: Miocene PreꞒ Ꞓ O S D C P T J K Pg N Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Reptilia Order: Testudines Suborder: Cryptodira Family: Chelydridae Genus: †AcherontemysHay, 1899 Species Acherontemys heckmani Hay, 1899 Acherontemys is an extinct genus of turtle from Miocene of United States. Taxonomy It was assigned to Chelydridae by Robert L. Carroll in 1988,[1] while Hutchison classified it w...

File decompression utility The UnarchiverOriginal author(s)Dag ÅgrenDeveloper(s)Circlesoft, MacPaw[1]Stable release4.3.6[2]  / 20 October 2022 Repositorynone Operating systemmacOS, Linux using GNUstep libraries, and command line only on Microsoft Windows, Linux, macOSAvailable in18 languagesList of languagesEnglish, Arabic, Bulgarian, Czech, Dutch, French, German, Hungarian, Italian, Japanese, Latvian, Norwegian Bokmål, Polish, Portuguese, Russian, Simplified Chinese, S...

This article is about a Munda language spoken in India. For a Nilotic language spoken in Africa, see Mandari dialect.Munda language spoken in eastern India Mundariमुंडारी, মুন্ডারি, ମୁଣ୍ଡାରୀ,

  هذه المقالة عن برج الحمام الذي يستعمل كعش للطيور. لمعانٍ أخرى، طالع مبدأ برج الحمام. برجيّ حمام في قرية التوفيقية بمحافظة البحيرة، مصر. بُرْج الحمام[1] أو تِمْراد[1] أو تِمْرِيد[2] أو رِيْع[1] هو مبنى مرتفع لطيور الحمام ويستعمل عشًا ومأوىً لهم ويكون من ال...

Indian filmmaker Not to be confused with Anu Malhotra (judge). Anu MalhotraAnu Malhotra during the making of Shamans of the HimalayasSelf-portrait photographBornAnu (1961-03-26) 26 March 1961 (age 62)New Delhi, Delhi, IndiaOccupation(s)Film Director, Presenter, ScreenwriterYears active1995–presentSpouseIqbal Malhotra Anu Malhotra is an Indian filmmaker on the subject of travel and expedition. She has written, directed, and hosted many television series, programs, films, and advert...

This article includes a list of general references, but it lacks sufficient corresponding inline citations. Please help to improve this article by introducing more precise citations. (July 2009) (Learn how and when to remove this template message) Deeside TramwayThe trackbed of the tramway east of Deeside quarryOverviewHeadquartersGlyndyfrdwyLocaleWalesDates of operation1870s–1947SuccessorAbandonedTechnicalTrack gauge2 ft 6 in (762 mm)Length3 miles The Deeside Tramwa...

1972 Hong Kong filmThe Black TavernDVD cover artTraditional Chinese黑店Simplified Chinese黑店Hanyu PinyinHēi Diàn Directed byTeddy YipWritten byYeh I-fangProduced byRun Run ShawStarringShih SzuCinematographyYau KeiEdited byChiang Hsing-lungLee Yim-hoiMusic byFrankie ChanWu DajiangProductioncompanyShaw Brothers StudioDistributed byShaw Brothers StudioRelease date 16 December 1972 (1972-12-16) Running time83 minutesCountryHong KongLanguageMandarin The Black Tavern is a...

State electoral district of Victoria, Australia MeltonVictoria—Legislative AssemblyLocation of Melton (dark green) in VictoriaStateVictoriaCreated1992MPSteve McGhiePartyLaborElectors53,306 (2018)Area332 km2 (128.2 sq mi)DemographicOuter metropolitan Electorates around Melton: Eureka Macedon Sunbury Eureka Melton Sydenham Eureka Werribee Kororoit The electoral district of Melton is an electoral district of the Victorian Legislative Assembly.[1] It contains the tow...

Questa voce sull'argomento chiese della Sicilia è solo un abbozzo. Contribuisci a migliorarla secondo le convenzioni di Wikipedia. Basilica di Sant'Antonio di PadovaProspettoStato Italia RegioneSicilia LocalitàMessina Coordinate38°11′01.33″N 15°33′00.9″E / 38.183702°N 15.550249°E38.183702; 15.550249Coordinate: 38°11′01.33″N 15°33′00.9″E / 38.183702°N 15.550249°E38.183702; 15.550249 Religionecattolica di rito romano OrdineRoga...

Lists of solar eclipsesGeometry of a total solar eclipse(not to scale) Solar eclipses in antiquity Solar eclipses in the Middle Ages Modern history 16th 17th 18th 19th 20th 21st The future 22nd Eclipses seen from Australia China Indonesia Philippines Russia Ukraine United Kingdom United States See also Lists of lunar eclipsesvte This list of solar eclipses visible from the Philippines enumerates the solar eclipse that have been and will be seen over the Philippines. A solar eclipse occurs whe...

Namma Metro's Green Line metro station Thalaghattapura Namma Metro stationA Green Line Namma Metro train at this metro station leading towards Silk Institute (Southbound) or towards Nagasandra (Northbound).General informationOther namesParamount GardensLocation15/3, Kanakapura Rd, Paramount Gardens, Talaghattapura, Bengaluru, Karnataka 560062Coordinates12°52′18″N 77°32′20″E / 12.871678475719564°N 77.5387583624092°E / 12.871678475719564; 77.5387583624092Owne...

Cet article est une ébauche concernant le sport et la Belgique. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations du projet sport. Comité olympique et interfédéral belge Sigle COIB Sport(s) représenté(s) Omnisports Création 1906 Président Jean-Michel Saive Siège Bruxelles Site internet Site officiel du COIB modifier  Le Comité olympique et interfédéral belge (COIB), en néerlandais : Belgisch Olympisch en Interfederaal C...

Ini adalah nama Melayu; nama Harun merupakan patronimik, bukan nama keluarga, dan tokoh ini dipanggil menggunakan nama depannya, Rina. Kata bin (b.) atau binti (bt.), jika digunakan, berarti putra dari atau putri dari. Yang Berbahagia Datuk SeriRina HarunDGSMرين هارونMenteri Wanita, Keluarga, dan Pembangunan Komunitas MalaysiaMasa jabatan10 Maret 2020 – 24 November 2022Perdana MenteriMuhyiddin YassinIsmail Sabri YaakobWakilSiti Zailah Mohd YusoffPendahuluWan Azizah Wan Isma...

Emerson Emerson at the 2012 FIFA Club World Cup finalPersonal informationFull name Márcio Passos de AlbuquerqueDate of birth (1978-09-06) 6 September 1978 (age 45)Place of birth Nova Iguaçu, BrazilHeight 1.71 m (5 ft 7+1⁄2 in)Position(s) Striker / WingerClub informationCurrent team FlamengoNumber 11Youth career1996–1998 São PauloSenior career*Years Team Apps (Gls)1998–1999 São Paulo 11 (2)2000 Consadole Sapporo 34 (31)2001 Kawasaki Frontale 18 (19)2001–2005...