Dow Chemical Classic
|
Read other articles:
Gurindam 12 oleh Raja Ali Haji (Pahlawan Nasional), Tanking Pining Contoh gurindam di Berita Adat Gurindam adalah salah satu jenis puisi yang memadukan antara sajak dan peribahasa. Jumlah baris pada gurindam hanya dua dengan rima a-a. Gurindam berisi ajaran yang berkaitan dengan budi pekerti dan nasihat keagamaan. Baris pada gurindam disebut sebagai syarat dan akibat. Syarat merupakan baris pertama dan akibat sebagai baris kedua.[1] Baris pertama membahas tentang persoalan, masalah at...
Manga Kimi to BokuCover of the first tankōbon volume君と僕。(Kimi to Boku)GenreComedy, slice of life MangaWritten byKiichi HottaPublished bySquare EnixImprintGangan ComicsMagazineMonthly Shōnen Gangan (2003–2004)Gangan Powered (2004–2009)Monthly GFantasy (2009–2022)DemographicShōnenOriginal runJanuary 2003 – March 18, 2022Volumes18 Anime television seriesDirected byMamoru KanbeProduced byShinnosuke WadaShuko YokoyamaYuji MatsukuraWritten byReiko Yoshida...
Staffhurst WoodSite of Special Scientific InterestLocationSurreyGrid referenceTQ 412 486[1]InterestBiologicalArea51.0 hectares (126 acres)[1]Notification1986[1]Location mapMagic Map Staffhurst Wood is a 51-hectare (130-acre) biological Site of Special Scientific Interest south of Oxted in Surrey.[1][2] It is a Nature Conservation Review site, Grade 2.[3] An area of 38.1 hectares (94 acres) is a Local Nature Reserve,[4][5] which i...
Der Titel dieses Artikels ist mehrdeutig. Weitere Bedeutungen sind unter Pappenheim (Begriffsklärung) aufgeführt. Wappen Deutschlandkarte 48.93472222222210.974444444444405Koordinaten: 48° 56′ N, 10° 58′ O Basisdaten Bundesland: Bayern Regierungsbezirk: Mittelfranken Landkreis: Weißenburg-Gunzenhausen Höhe: 405 m ü. NHN Fläche: 64,32 km2 Einwohner: 3969 (31. Dez. 2022)[1] Bevölkerungsdichte: 62 Einwohner je km2 Postleit...
Albstadt Entidad subnacional Escudo AlbstadtLocalización de Albstadt en Alemania Coordenadas 48°12′43″N 9°01′26″E / 48.211944444444, 9.0238888888889Idioma oficial AlemánEntidad Municipio urbano de Alemania, Ciudad y Greater district town in Baden-Württemberg • País Alemania AlemaniaDirigentes • Alcalde Jürgen Gneveckow (CDU)Superficie • Total 134,41 km²Altitud • Media 731 m s. n. m.Población (31/12/201...
Статтю «Чортківське гето» створено в рамках місяця Другої світової війни(9 квітня 2012 року — 9 травня 2012 року) Ця стаття є частиною Проєкту:Тернопільщина (рівень: III, важливість: середня) Портал «Тернопільщина»Мета проєкту — створення якісних та інформативних статей на тем
London Underground station, 1901–1922 City RoadThe station remains in 2004City RoadLocation of City Road in Central LondonLocationCity RoadLocal authorityIslingtonOwnerCity & South London RailwayNumber of platforms2Key dates17 November 1901 (1901-11-17)Opened8 August 1922 (1922-08-08)ClosedOther informationWGS8451°31′47″N 0°05′51″W / 51.52972°N 0.09750°W / 51.52972; -0.09750 London transport portal City Road is a...
BerthieriteGeneralCategoryMineralFormula(repeating unit)FeSb2S4IMA symbolBtr[1] vStrunz classification2.HA.20Crystal systemOrthorhombicCrystal classDipyramidal (mmm) H-M symbol: (2/m 2/m 2/m)Space groupPnamIdentificationColorsteel greyCleavagepoor/indistinctMohs scale hardness2-3LustermetallicDiaphaneityopaqueSpecific gravity4.64 Berthierite is a mineral, a sulfide of iron and antimony with formula FeSb2S4. It is steel grey in colour with a metallic lustre which can be covered by an i...
Process of pairing in biologyThis article is about sexual reproduction. For the mating of mechanical components, see Engineering fit. For the 1991 American novel, see Mating (novel). This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Mating – news · newspapers · books · scholar · JSTOR (November 2013) (Learn ho...
Railway station in Nasukarasuyama, Tochigi Prefecture, Japan This article relies largely or entirely on a single source. Relevant discussion may be found on the talk page. Please help improve this article by introducing citations to additional sources.Find sources: Kobana Station – news · newspapers · books · scholar · JSTOR (August 2022) Kobana Station小塙駅Kobana Station in August 2008General informationLocationKobana, Nasukarasuyama-shi, Tochigi-...
De schietsport is een van de sporten die beoefend werden tijdens de Olympische Zomerspelen 2004 in Athene. Heren kleinkalibergeweer 50 m drie houdingen Medaille-uitreiking kleinkalibergeweer 50 m drie houdingen heren rang sporter land score finale totaal 1 Jia Zhanbo CHN 1171 93.5 1264.5 2 Michael Anti USA 1165 98.1 1263.1 3 Christian Planer AUT 1167 95.8 1262.8 4 Rajmond Debevec SLO 1166 96.6 1262.6 5 Artjom Chadzjibekov RUS 1164 97.6 1261.6 6 Thomas Farnik ...
British politician SirGerald HowarthParliamentary Under-Secretary of State for International Security StrategyIn office12 May 2010 – 4 September 2012Prime MinisterDavid CameronPreceded byThe Baroness Taylor of BoltonSucceeded byAndrew MurrisonMember of Parliament for AldershotIn office1 May 1997 – 3 May 2017Preceded byJulian CritchleySucceeded byLeo DochertyMember of Parliament for Cannock and BurntwoodIn office9 June 1983 – 16 March 1992Preceded byGwilym Robe...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
Dies ist eine Liste der österreichischen Gesandten und (seit 1961) Botschafter im Königreich Dänemark.[1][2] Inhaltsverzeichnis 1 Missionschefs 1.1 Habsburgische Gesandte (bis 1804) 1.2 k.k. Österreichische Gesandte 1.3 k.u.k. Österreichisch-ungarische Gesandte 1.4 Österreichische Botschafter (seit 1919) 2 Siehe auch 3 Einzelnachweise 4 Weblinks Missionschefs Habsburgische Gesandte (bis 1804) 1691: Aufnahme diplomatischer Beziehungen ... 1713–1720: Ignaz Schmid 1720–...
Burmese university in Pyay Pyay Technological Universityပြည်နည်းပညာတက္ကသိုလ်TypePublicEstablished18 December 1999; 23 years ago (18 December 1999)RectorNyunt SoeLocationPyay, Bago Region, MyanmarAffiliationsMinistry of EducationWebsitewww.ptu.edu.mm,ptu.moe.edu.mm Pyay Technological University (PTU) (Burmese: ပြည်နည်းပညာတက္ကသိုလ်, pronounced [pjè nípjɪ̀ɰ̃ɲà tɛʔkəθò]), in Pyay, is ...
هذه المقالة تحتاج للمزيد من الوصلات للمقالات الأخرى للمساعدة في ترابط مقالات الموسوعة. فضلًا ساعد في تحسين هذه المقالة بإضافة وصلات إلى المقالات المتعلقة بها الموجودة في النص الحالي. (ديسمبر 2019) لحظة ظلاممعلومات عامةالتصنيف فيلم تلفزيوني تاريخ الصدور 2003 اللغة الأصلية الع...
Youtube American chef Max MillerCreator and host of Tasting History, Max MillerBorn (1983-03-30) March 30, 1983 (age 40)Phoenix, Arizona, U.S.Alma materArizona State UniversitySpouse Jose Mendoza (m. 2021)YouTube informationChannelsTasting History with Max MillerKetchup with Max and JoseYears active2020–presentGenresCookinghistorySubscribers2.03 millionTotal views217 million Creator Awards100,000 subscribers20201,000,000 subscribers2021 Las...
Biografi ini memerlukan lebih banyak catatan kaki untuk pemastian. Bantulah untuk menambahkan referensi atau sumber tepercaya. Materi kontroversial atau trivial yang sumbernya tidak memadai atau tidak bisa dipercaya harus segera dihapus, khususnya jika berpotensi memfitnah.Cari sumber: Ahmed III – berita · surat kabar · buku · cendekiawan · JSTOR (Pelajari cara dan kapan saatnya untuk menghapus pesan templat ini) Ahmed III Ahmed III (Bahasa Turki Utsma...
The first recorded photo of Boca Juniors taken in 1906, after winning the Copa Reformista of Liga Central The following is a complete list of Club Atlético Boca Juniors seasons since 1908 to present. Competitions contested include domestic and international cups and tournaments. On 3 April 1905, a group of Greek and Italian boys (more specifically from Genoa) met in order to find a club. The house where the meeting was arranged was Esteban Baglietto's and the other four people who attended w...
هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أبريل 2023) محمد فيض الله معلومات شخصية الميلاد سنة 1892 الوفاة سنة 1976 (83–84 سنة) بنغلاديش الحياة العملية المدرسة الأم الجامعة الأهلية دار العلوم معين الإسلام...
Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!