Read other articles:

Grimm & Triepel Kruse-Kautabak Logo Rechtsform GmbH Gründung 14. Juni 1849 Auflösung Dezember 2016 Sitz Witzenhausen-Unterrieden, Hessen Leitung Heidrun KruseBernd-Otto Kruse Branche Kautabak Website https://grimm-triepel.de Die Grimm & Triepel Kruse-Kautabak GmbH war zwischen 1849 und 2016 ein deutscher Hersteller von Kautabak. Sitz war Witzenhausen-Unterrieden im Werra-Meißner-Kreis im Nordosten von Hessen. Inhaltsverzeichnis 1 Geschichte 2 Literatur 3 Weblinks 4 Einzelnachweise ...

Logo Das Dolby Cinema ist ein Premium-Kino-Produkt der Dolby Laboratories, welches sich insbesondere durch die Verwendung von Dolby Vision und Dolby Atmos in Kombination mit einem speziellen Design des Kinosaals auszeichnet. Die technische Minimalausstattung und das Design werden dabei durch Dolby festgelegt. Der bekannteste Konkurrent ist IMAX. Inhaltsverzeichnis 1 Geschichte 2 Technik 2.1 Projektoren 2.2 Ton 3 Design 3.1 Eingang 3.2 Farben 3.3 Bestuhlung 3.4 Saal 4 Installationen (Auswahl) ...

Ця стаття є частиною Проєкту:Історія (рівень: 3, важливість: Найвища) Портал «Історія»Мета проєкту — створення якісних та інформативних статей на теми, пов'язані з історією. Ви можете покращити цю статтю, відредагувавши її, а на сторінці проєкту вказано, чим ще можна допом�...

High school in Virginia Beach, Virginia, United StatesFrank W. Cox High SchoolAddress2425 Shorehaven DriveVirginia Beach, Virginia 23454United StatesInformationSchool typePublic, high schoolMottoDedicated to ExcellenceFounded1961School districtVirginia Beach City Public SchoolsSuperintendentAaron C. SpencePrincipalMichael D. KellyGrades9-12Enrollment1,715[2] (2021-22)Color(s)      Forest Green, Gold, and SilverAthletics conferenceVirginia High School LeagueBeach Di...

Package freighter that served ports on the Upper Great Lakes United States historic placePewabic (propeller) shipwreck siteU.S. National Register of Historic Places The Pewabic prior to her sinkingShow map of MichiganShow map of the United StatesLocationLake Huron[2]Nearest cityAlpena Township, MichiganCoordinates44°57′53″N 83°6′14″W / 44.96472°N 83.10389°W / 44.96472; -83.10389NRHP reference No.14001096[1]Added to NRHPAugust 22, 2...

Dalam nama Tionghoa ini, nama keluarganya adalah Yiin. Yiin Chii-ming尹啟銘Menteri tanpa Portofolio Yuan EksekutifMasa jabatan20 Mei 2012 – 17 Februari 2013Menteri Dewan Perencanaan dan Pembangunan Ekonomi Republik TiongkokMasa jabatan6 Februari 2012 – 17 Februari 2013WakilChen Hsiao-hungPendahuluChristina LiuPenggantiKuan Chung-mingMenteri tanpa Portofolio Yuan EksekutifMasa jabatan16 November 2009 – 2 Desember 2011Menteri Urusan Ekonomi Republik TiongkokM...

German television program For the current season, see Promi Big Brother (season 11). For the regular edition of the series, see Big Brother (German TV series). Promi Big BrotherThe eye logo since season 7.GenreRealityCreated byJohn de MolPresented by Oliver Pocher Cindy aus Marzahn Jochen Schropp Jochen Bendel Marlene Lufen Country of originGermanyOriginal languageGermanNo. of seasons10No. of episodesapprox. 170ProductionRunning time50-211 minutesOriginal releaseNetworkSat.1Release13 Septembe...

Artikel ini tidak memiliki referensi atau sumber tepercaya sehingga isinya tidak bisa dipastikan. Tolong bantu perbaiki artikel ini dengan menambahkan referensi yang layak. Tulisan tanpa sumber dapat dipertanyakan dan dihapus sewaktu-waktu.Cari sumber: Pergudangan – berita · surat kabar · buku · cendekiawan · JSTORArtikel ini berisi konten yang ditulis dengan gaya sebuah iklan. Bantulah memperbaiki artikel ini dengan menghapus konten yang dianggap seba...

1959 British thriller The 39 StepsOriginal British cinema posterDirected byRalph ThomasScreenplay byFrank HarveyBased onThe Thirty-Nine Steps1915 novelby John BuchanProduced byBetty E. BoxStarringKenneth MoreTaina ElgBrenda De BanzieBarry JonesReginald BeckwithSid JamesCinematographyErnest StewardEdited byAlfred RoomeMusic byClifton ParkerProductioncompanyThe Rank OrganisationDistributed byRank Film DistributorsRelease date 12 March 1959 (1959-03-12) Running time93 minutesCount...

Canadian football team Winnipeg Blue Bombers Founded1930Based inWinnipeg, Manitoba, CanadaHome fieldOsborne Stadium (1935–1952)Canad Inns Stadium (1953–2012)IG Field (2013–present)Head coachMike O'SheaGeneral managerKyle WaltersTeam presidentWade MillerOwner(s)Winnipeg Football Club (a non-profit corporation)LeagueCanadian Football LeagueDivisionWest DivisionColoursRoyal blue, gold, white[1][2][3]     Nickname(s)Bombers, Blue and Gold, Big Blue, Tr...

1966–67 National Hurling LeagueLeague detailsDates2 October 1966 – 1 October 1967Teams28League championsWinnersWexford (3rd win)Other division winnersDivision 2KerryDivision 3Louth← 1965–66 1967–68 → The 1966–67 National Hurling League was the 36th season of the National Hurling League. Division 1 Football league seasonNational Hurling League Division 1Season1966-67ChampionsWexford 3rd National League titleCaptain: Jimmy O'BrienMatches played26Top goalscorer Eddie Keher ...

Este artigo ou seção é sobre um evento desportivo que ainda não ocorreu. As informações apresentadas podem mudar com frequência à medida que os eventos se aproximam. Não adicione especulações, nem textos sem referências ou fontes confiáveis; melhore-o de acordo com as recomendações dos projetos correspondentes. Esta página apresenta trechos escritos usando mais do que uma variante de português. Se consegue identificar qual é a variante dominante e tem bons conhecimentos ness...

Swedish TV series or program Peter-No-TailGenreChristmas calendarCreated byGösta KnutssonWritten byPernilla OljelundStarringBjörn KjellmanCecilia LjungChrister FantBrasse BrännströmNarrated byGösta PrüzeliusCountry of originSwedenOriginal languageSwedishNo. of episodes24Original releaseRelease1 December (1997-12-01) –24 December 1997 (1997-12-24) Peter-No-Tail (Swedish: Pelle Svanslös) is a 1997 Swedish Live-Action SVT's Christmas calendar TV series initiated by S...

Historical dynasty based in Ghazni and Gardez Lawik dynastyc.750 CE–977 CE Ghazni was the power-center of the Lawik dynasty. Citadel of Ghazni pictured above LAWIKDYNASTYSAFFARIDSSAMANIDSABBASIDCALIPHATEBYZANTINEEMPIREGUJARA-PRATIHARAPALA EMPIREUTPALADYNASTYHINDUSHAHISclass=notpageimage| Approximate location of the Lawik dynastyHindu ShahisLAWIKSSamarkandHeratSAFFARIDS/SAMANIDS/GhaznavidsBalkhKandaharGhazniGardezKabulHundUTPALADYNASTYKHUDAHSBukharaAFSHINSBostclass=notpageimage| The Lawik Dy...

Highway in Western Australia This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: South Coast Highway – news · newspapers · books · scholar · JSTOR (January 2013) (Learn how and when to remove this template message) South Coast HighwayWestern AustraliaMap of south-west Western Australia with South Coast Highway h...

Legal procedure For other uses, see Defence (disambiguation). Defence counsel redirects here. Not to be confused with Defence Council. This article may need to be rewritten to comply with Wikipedia's quality standards. You can help. The talk page may contain suggestions. (May 2009) This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Defense l...

Perenjak gunung Perenjak gunung, Prinia superciliaris dysancritadari Sei Karang, Galang, Deli Serdang Status konservasi Risiko Rendah (IUCN 3.1)[1] Klasifikasi ilmiah Kerajaan: Animalia Filum: Chordata Kelas: Aves Ordo: Passeriformes Famili: Cisticolidae Genus: Prinia Spesies: P. superciliaris Nama binomial Prinia superciliaris(Anderson, 1871) Sinonim Saya superciliaris Anderson, 1871[2] (basionym) Perenjak gunung[3]:358 (Prinia superciliaris) adalah spesies ...

Species of rodent Mindanao squirrel Conservation status Least Concern (IUCN 3.1)[1] Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Mammalia Order: Rodentia Family: Sciuridae Genus: Sundasciurus Species: S. mindanensis Binomial name Sundasciurus mindanensis(Steere, 1890) The Mindanao squirrel (Sundasciurus mindanensis) is a species of rodent in the family Sciuridae. It is endemic to the Philippines. References ^ Chiozza, F. (2016). Sunda...

Belgian road racing cyclist Tim WellensWellens at the 2014 Ronde van LimburgPersonal informationFull nameTim WellensBorn (1991-05-10) 10 May 1991 (age 32)Sint-Truiden, Flanders, BelgiumHeight1.83 m (6 ft 0 in)Weight65 kg (143 lb)Team informationCurrent teamUAE Team EmiratesDisciplinesRoadRoleRiderRider typeAll-rounderAmateur teams2009Avia Cycling Team2010–2012Davo–Lotto Professional teams2012–2022Lotto–Belisol[1][2][3 ...

The Princess and the Pirate Título La princesa y el pirataFicha técnicaDirección David ButlerProducción Samuel GoldwynGuion Everett FreemanDon HartmanMelville ShavelsonBasada en una historia de Sy BartlettMúsica David RoseMaquillaje Robert AltonFotografía Victor MilnerWilliam E. SnyderMontaje Daniel MandellProtagonistas Bob HopeVirginia Mayo Ver todos los créditos (IMDb)Datos y cifrasPaís  Estados UnidosAño 1944Género AventurasDuración 94 minutosIdioma(s) InglésCompañíasPro...