Furna do Carregadouro

A Furna do Carregadouro é uma gruta portuguesa localizada na freguesia de Santa Luzia, concelho de São Roque do Pico, ilha do Pico, arquipélago dos Açores.

Esta cavidade apresenta uma geomorfologia de origem vulcânica em forma de tubo de lava localizado de encosta em campo de lava. Apresenta um comprimento de 20 m. por uma altura máxima de 2 m. e por uma largura também máxima de 6 m.

Ver também

Ligações externas

Ícone de esboço Este artigo sobre geografia dos Açores é um esboço. Você pode ajudar a Wikipédia expandindo-o.

Read other articles:

Canadian politician Not to be confused with John O'Donohue. The HonourableJohn O'DonohoeMember of the Canadian Parliamentfor Toronto EastIn officeMarch 26, 1874 – November 26, 1874Preceded byJames Beaty, Sr.Succeeded bySamuel PlattSenator from OntarioIn officeMay 21, 1882 – December 7, 1902 Personal detailsBorn(1824-04-18)April 18, 1824Tuam, Galway, IrelandDiedDecember 7, 1902(1902-12-07) (aged 78)Toronto, Ontario, Canada[1]Political partyLiberal John O'Dono...

 

يفتقر محتوى هذه المقالة إلى الاستشهاد بمصادر. فضلاً، ساهم في تطوير هذه المقالة من خلال إضافة مصادر موثوق بها. أي معلومات غير موثقة يمكن التشكيك بها وإزالتها. (يوليو_2012) الحزب الشيوعي الثوري (اللجنة التنظيمية) هي منظمة شيوعية ومقرها كندا تدعو إلى إسقاط النظام الرأسمالي والحز...

 

О младшем сыне Густава VI см. Бернадот, Карл Юхан (граф Висборгский). В Википедии есть статьи о других людях с именем Карл. Карл XIV ЮханCarl XIV Johan Король Швеции 5 февраля 1818 года — 8 марта 1844 года Коронация 11 мая 1818 Предшественник Карл XIII Преемник Оскар I Король Норвегии 5 ф

2022 National League Championship Series Team (Wins) Manager(s) Season Philadelphia Phillies (4) Rob Thomson 87–75 (.537), GB: 14 San Diego Padres (1) Bob Melvin 89–73 (.549), GB: 22DatesOctober 18–23MVPBryce Harper (Philadelphia)UmpiresLance Barrett, Ted Barrett (crew chief), Doug Eddings, Adam Hamari, Brian Knight, Todd Tichenor, Quinn WolcottBroadcastTelevisionFS1 (Games 1–3 and 5)Fox (Games 2, 4)TV announcersJoe Davis, John Smoltz, Ken Rosenthal, and Tom VerducciRadioESPNRadio ann...

 

2011 studio album by Brandon HeathLeaving EdenStudio album by Brandon HeathReleasedJanuary 18, 2011GenreContemporary Christian musicLength43:43LabelReunionProducerDan MuckalaBrandon Heath chronology What If We(2008) Leaving Eden(2011) Blue Mountain(2012) Singles from Leaving Eden Your LoveReleased: September 14, 2010[1] The Light in MeReleased: April 29, 2011[2] Leaving EdenReleased: October 2011 Leaving Eden is the third studio album by contemporary Christian musician...

 

  لمعانٍ أخرى، طالع الولي (توضيح). جزء من سلسلة مقالات حولالله في الإسلام مصطلحاتالتسبيح: سبحان الله التكبير: الله أكبر الحمد: الحمد لله التشهّد: لا إله إلّا الله تعابير مرتبطة جلَّ جلاله سبحانه وتعالى عزَّ وجلّ أخرى إنَّا لله بسم الله إن شاء الله ما شاء الله استغفر الله...

У Вікіпедії є статті про інших людей із прізвищем Кемпбелл. У Вікіпедії є статті про інших людей із прізвищем Браун. Veronica Campbell-BrownVeronica Angella Campbell-Brown англ. Veronica Campbell-Brown Загальна інформаціяНаціональність ямайкаГромадянство  ЯмайкаМісце проживання КлермонтНародження 16 т...

 

Servette Football Club Chênois Féminin Datos generalesNombre Servette Football Club Chênois FémininApodo(s) SFCCFFundación 1974 (CS Chênois)2012 (se independiza de CS Chênois) 2017 (se convierte en la sección femenina del Servette FC)Colores Granate, rojo y blancoPresidente Pascal BesnardEntrenador Éric SévéracInstalacionesEstadio Stade de MarignacCapacidad 1.000Ubicación Vernier, SuizaUniforme Titular Alternativo Tercero Última temporadaLiga Superliga Femenina(2020-21) CampeónT...

 

Portuguese footballer In this Portuguese name, the first or maternal family name is Ribeiro and the second or paternal family name is Dias. Cafú Cafú (right) playing for Portugal U19Personal informationFull name Carlos Miguel Ribeiro Dias[1]Date of birth (1993-02-26) 26 February 1993 (age 30)[1]Place of birth Guimarães, Portugal[1]Height 1.85 m (6 ft 1 in)[1]Position(s) MidfielderTeam informationCurrent team Rotherham UnitedNumber 7Yo...

У Вікіпедії є статті про інших людей із прізвищем Брик. |портрет= |Батько= |Посада= |Діти= |Мати= |Дружина= Михайло Теодорович БрикНародився 1 січня 1941(1941-01-01)с. Юстинівка, Підгаєцький район, Тернопільська областьПомер 5 березня 2006(2006-03-05) (65 років)КиївКраїна  СРСР,  Україна...

 

Felicia LisardiLahir24 Agustus 1991 (umur 32) Jakarta, IndonesiaPekerjaanPembawa acara, aktris, jurnalis Felicia Lisardi (lahir 24 Agustus 1991) adalah aktris, jurnalis, pembawa acara Indonesia. Ia menjadi anchor dalam program reality remaja Teenlicious. Dia memulai karier pada tahun 2008 setelah memenangkan pemilihan Starteen. Sinetron The Lobby (2014) Pranala luar (Indonesia) Twitter resmi Felicia Lisardi Diarsipkan 2009-09-21 di Wayback Machine. Artikel bertopik biografi Indonesia ini...

 

German actress This article includes a list of references, related reading, or external links, but its sources remain unclear because it lacks inline citations. Please help to improve this article by introducing more precise citations. (March 2013) (Learn how and when to remove this template message) Judy WinterBornBeate Richard (1944-01-04) 4 January 1944 (age 79)Friedland, Upper Silesia, Prussia, GermanyOccupationActressWebsitejudy-winter.de Judy Winter (pronounced [ˈd͡ʒuː.di ...

Digital cable smart card A Motorola CableCARD. CableCARD is a special-use PC Card device that allows consumers in the United States to view and record digital cable television channels on digital video recorders, personal computers and television sets on equipment such as a set-top box not provided by a cable television company. The card is usually provided by the local cable operator, typically for a nominal monthly fee. In a broader context, CableCARD refers to a set of technologies created...

 

CDC42EP3 المعرفات الأسماء المستعارة CDC42EP3, BORG2, CEP3, UB1, CDC42 effector protein 3 معرفات خارجية الوراثة المندلية البشرية عبر الإنترنت 606133 MGI: MGI:2384718 HomoloGene: 4708 GeneCards: 10602 علم الوجود الجيني الوظيفة الجزيئية • ‏GO:0005097، ‏GO:0005099، ‏GO:0005100 GTPase activator activity• cytoskeletal regulatory protein binding• ‏GO:0001948، ‏GO:0016582 ربط بر...

 

Cet article est une ébauche concernant les grandes écoles. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. École Supérieure d'Ingénieurs de l'Université de Caen Basse-NormandieHistoireFondation 2009StatutType École d'ingénieurs publique interne à l'Université de Caen Basse-NormandieDirecteur Rachid MakhloufiSite web www.unicaen.fr/esix ou http://esix.unicaen.frChiffres-clésÉtudiants 505 (2023)[1]Ensei...

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Haiwan – news · newspapers · books · scholar · JSTOR (May 2019) (Learn how and when to remove this template message) 1977 Indian filmHaiwanDirected byRam RanoMusic byBappi LahiriRelease date1977CountryIndiaLanguageHindi Haiwan is a 1977 Bollywood musical film t...

 

1761 coronation in Great Britain Coronation of George III and CharlotteKing George III and Queen Charlotte in coronation robes, by Allan RamsayDate22 September 1761 (1761-09-22)LocationWestminster Abbey, London, EnglandBudget£9,430 (£70,000 according to other sources)Participants King George III Queen Charlotte Great Officers of State Archbishops and Bishops Assistant of the Church of England Garter Principal King of Arms Peers of the Realm Mistress of the Robes The coro...

 

Historical dynasty based in Ghazni and Gardez Lawik dynastyc.750 CE–977 CE Ghazni was the power-center of the Lawik dynasty. Citadel of Ghazni pictured above LAWIKDYNASTYSAFFARIDSSAMANIDSABBASIDCALIPHATEBYZANTINEEMPIREGUJARA-PRATIHARAPALA EMPIREUTPALADYNASTYHINDUSHAHISclass=notpageimage| Approximate location of the Lawik dynastyHindu ShahisLAWIKSSamarkandHeratSAFFARIDS/SAMANIDS/GhaznavidsBalkhKandaharGhazniGardezKabulHundUTPALADYNASTYKHUDAHSBukharaAFSHINSBostclass=notpageimage| The Lawik Dy...

Fictional character from the X-Men franchise This article is about the Marvel Comics character. For the DC Comics planet, see Apokolips. Comics character ApocalypseApocalypse on Ariel Olivetti's variant cover ofCable (vol. 2) #15 (August 2009)Publication informationPublisherMarvel ComicsFirst appearanceCameo appearance: X-Factor #5 (June 1986) Full appearance: X-Factor #6 (July 1986)Created byLouise Simonson (writer)Walter Simonson (artist)In-story informationAlter egoEn Sabah NurSpeciesHuman...

 

Fictional character from the Karate Kid franchise This article's lead section may be too short to adequately summarize the key points. Please consider expanding the lead to provide an accessible overview of all important aspects of the article. (November 2022) Fictional character Mr. MiyagiThe Karate Kid characterPat Morita as Mr. Miyagi in The Karate Kid.First appearanceThe Karate Kid (1984)Last appearanceCobra Kai (2018)Created byRobert Mark KamenPortrayed byPat MoritaVoiced by Robert Ito P...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!