Made to Love
|
Read other articles:
Dunia Harry Potter merupakan latar tempat dari kejadian-kejadian yang terdapat pada novel fantasi Harry Potter karya J. K. Rowling. Lokasi-lokasi tersebut bisa dikategorikan sebagai tempat tinggal, sekolah, kawasan perbelanjaan, atau bangunan milik pemerintah. Tempat tinggal The Burrow Kediaman keluarga Weasleys, yang dikenal sebagai The Burrow, terletak di luar desa Ottery St Catchpole, yang juga dekat dengan kediaman keluarga Lovegood, Diggory dan Fawcett. The Burrow pernah digunakan sebaga...
American lawyer and politician James Lot RidgelyBorn(1807-01-27)January 27, 1807Baltimore, Maryland, U.S.DiedNovember 16, 1881(1881-11-16) (aged 74)Baltimore, Maryland, U.S.Occupationlawyer Part of a series onOdd Fellows General articles Odd Fellows Grand lodge Governing bodies Independent Order of Odd Fellows Independent Orderof Oddfellows Manchester Unity Grand United Order of Oddfellows Auxiliariesand appendant bodies International Associationof Rebekah Assemblies Household of Ruth An...
هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقالات متعلقة بها. (أغسطس 2022) توماس رونو معلومات شخصية الميلاد 5 مارس 1984 (العمر 39 سنة)أورليان الطول 1.84 م (6 قدم 1⁄2 بوصة) مركز اللعب حارس مرمى الجنسية فرنسا مناصب [1] ...
Rahasia SukudomasMimi Mariani dalam Rahasia Sukudomas (1954)Sutradara Tan Sing Hwat Produser Tan Sing Hwat Ditulis oleh Tan Sing Hwat PemeranRisa Umami Mimi MarianiPenata musikLeung ShunSinematograferLo King Hoo Lukman Hakim NainPenyuntingLo King Hoo Tan Sing HwatDistributorGaruda Film Nusantara FilmTanggal rilis1954Negara Indonesia Bahasa Indonesia Rahasia Sukudomas adalah film drama Indonesia tahun 1954 yang diproduksi dan disutradarai oleh Tan Sing Hwat serta dibintangi oleh Risa Uma...
Reserva da Aldeia Histórica de Holašovice ★ Património Mundial da UNESCO Tipo Cultural Critérios ii, iv Referência 861 Região ♦ Europa e América do Norte País Chéquia Coordenadas 48° 57′ 35″ N, 14° 15′ 10″ L Histórico de inscrição Inscrição 1998 ★ Nome usado na lista do Património Mundial ♦ Região segundo a classificação pela UNESCO Holašovice é uma pequena vila histórica localizada ao sul da República Checa, a 15 quilômetros a oeste de...
Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada Januari 2023. Perbatasan Arab Saudi–Yordania memiliki panjang 731 km (454 mi) dan membentang dari Teluk Aqaba di barat daya hingga pertigaan dengan Irak di timur laut.[1] Peta Yordania dengan Arab Saudi di tenggara; segitiga besar tanah di Arab S...
This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: World War II in the Slovene Lands – news · newspapers · books · scholar · JSTOR (May 2012) (Learn how and when to remove this template message) Part of a series on the History of Slovenia Italy / Noricum / Pannonia Slavic settlement of the Eas...
15th Signal BrigadeShoulder Sleeve InsigniaCountryUnited StatesBranchU.S. ArmyRoleAdvanced Individual TrainingPart ofTRADOCGarrison/HQFort EisenhowerNickname(s)TEAM 15Motto(s)Fideliter ServimusFaithfully We ServeFaithful ServiceColors Orange and white are the colors traditionally associated with the Signal Corps.WebsiteOfficial websiteInsigniaDistinctive Unit InsigniaIdentificationsymbolA gold color metal and enamel device that consists of a shield blazoned as follows: Per be...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
State in Western India State in West India, IndiaMaharashtraStateState of Maharashtra From top, left to right: Ajanta Caves, Kailasa Temple at Ellora Caves, Pratapgad Fort (near Mahabaleshwar) located in the Western Ghats, Statue of Shivaji, Raigad, Shaniwar Wada, Hazur Sahib Nanded, Chhatrapati Shivaji Maharaj Terminus, The Gateway of India Emblem of MaharashtraEtymology: mahā (Great) and Sanskritized form of Ratta dynastyNickname: Gateway of IndiaMotto(s): Pratipaccandralēkhēva...
Play by Voltaire MahometFrontispiece of the 1753 editionWritten byVoltaireCharactersMahomet, founder of IslamZopir, leader of MeccaOmar, general and lieutenant to MahometSeid, Zopir's son, abducted and enslaved by MahometPalmira, Zopir's daughter, abducted and enslaved by MahometPhanor, senator of MeccaMeccan tribesMahomet's followersDate premiered25 April 1741Place premieredLille, FranceOriginal languageFrenchSubjectReligious fanaticismGenreTragedy Mahomet (French: Le fanatisme, ou Mahomet l...
Microsoft EncartaPengembangMicrosoftRilis stabilEncarta Premium 2009 / Agustus 2008 Sistem operasiMicrosoft WindowsJenisEnsiklopedia virtualLisensiKomersialSitus webencarta.msn.com[pranala nonaktif] Encarta adalah ensiklopedia digital multimedia yang dibuat oleh Microsoft Corporation. Sampai dengan tahun 2008, Encarta Premium mengandung sekitar 62.000 artikel dengan banyak foto dan ilustrasi, klip musik, video, game interaktif, dan semua itu terdapat di World Wide Web dengan setiap ta...
Archeological site in Italy Coddu VecchiuGiants' grave Coddu Vecchiu (Sardegna)Shown within SardiniaCoordinates41°03′01″N 9°21′21″E / 41.05025°N 9.3558°E / 41.05025; 9.3558TypeMonumentHistoryMaterialGraniteFoundedc. 1800–1600 BCCulturesNuragic civilizationSite notesExcavation dates1966ArchaeologistsEditta CastaldiConditionruinedManagementI Beni Culturali della SardegnaPublic accessyesWebsiteArzachena, tomba di giganti di Coddu Vecchiu (in Italia...
Railway station in Chipping Sodbury, South Gloucestershire, England Chipping SodburyThe remains of the station viewed from the west.General informationLocationChipping Sodbury, South GloucestershireEnglandCoordinates51°31′56″N 2°22′44″W / 51.5323°N 2.379°W / 51.5323; -2.379Grid referenceST736815Platforms2Other informationStatusDisusedHistoryOriginal companyGreat Western RailwayPre-groupingGWRPost-groupingGWRKey dates1 July 1903 (1903-07-01)St...
For other uses, see Dunblane. Place in Saskatchewan, CanadaGhost town of DunblaneLocation of Dunblane in SaskatchewanShow map of SaskatchewanDunblane, Saskatchewan (Canada)Show map of CanadaCoordinates: 51°11′00″N 106°52′02″W / 51.183333°N 106.867222°W / 51.183333; -106.867222CountryCanadaProvinceSaskatchewanRegionSaskatchewanRural MunicipalityCoteauPost office Founded1914-05-01 (Closed 1979-06-06)Incorporated (Village)N/ADissolvedMay 1, 1975 [1]Tim...
1970 studio album by Flip WilsonThe Devil Made Me Buy This DressStudio album by Flip WilsonReleasedFebruary 1970GenreComedyLabelLittle David RecordsProducerMonte Kay, Jack LewisFlip Wilson chronology You Devil You(1968) The Devil Made Me Buy This Dress(1970) The Flip Wilson Show(1970) Professional ratingsReview scoresSourceRatingAllmusic[1] The Devil Made Me Buy This Dress is the fourth comedy album by American comedian Flip Wilson, and the first record released by Little Davi...
Place in Bamingui-Bangoran, Central African RepublicAkourousoulbaAkourousoulbaLocation in the Central African RepublicCoordinates: 8°58′N 20°46′E / 8.967°N 20.767°E / 8.967; 20.767Country Central African RepublicPrefectureBamingui-BangoranSub-prefectureN'DéléTime zoneUTC + 1 Akourousoulba or Akoursoulbak is a village in the Bamingui-Bangoran Prefecture in the northern Central African Republic. History FPRC fighter in Akourousoulba, April 2018 Akourousoulba us...
Suburb of Christchurch, New Zealand Suburb in Christchurch, New ZealandBexleySuburbBexley ParkCoordinates: 43°30′50″S 172°42′50″E / 43.51389°S 172.71389°E / -43.51389; 172.71389CountryNew ZealandCityChristchurchLocal authorityChristchurch City CouncilElectoral wardLinwoodCommunity boardWaitai Coastal-Burwood-LinwoodArea[1] • Land90 ha (220 acres)Population (June 2023)[2] • Total2,680 Aranui Wainoni Bexl...
Monsteroux-MilieucomuneMonsteroux-Milieu – Veduta LocalizzazioneStato Francia RegioneAlvernia-Rodano-Alpi Dipartimento Isère ArrondissementVienne CantoneRoussillon TerritorioCoordinate45°26′N 4°57′E / 45.433333°N 4.95°E45.433333; 4.95 (Monsteroux-Milieu)Coordinate: 45°26′N 4°57′E / 45.433333°N 4.95°E45.433333; 4.95 (Monsteroux-Milieu) Superficie8,22 km² Abitanti748[1] (2009) Densità91 ab./km² Altre informazioniCo...
Pedro III de Portugal Consorte de Portugal (es) 1777 - 1786 Co-Monarca de Portugal (es) VidaNacimientu Lisboa, 5 de xunetu de 1717[1]Nacionalidá Reinu de PortugalLlingua materna portuguésMuerte Sintra, 25 de mayu de 1786[1] (68 años)Sepultura Ilesia de São Vicente de ForaCausa de la muerte accidente vascular cerebralFamiliaPadre Juan V de PortugalMadre María Ana d'AustriaCasáu con María I de Portugal (es) (1760 – )[...