Fairfield (Idaho)
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Read other articles:
Romano Canavesecomune Romano Canavese – VedutaPanorama LocalizzazioneStato Italia Regione Piemonte Città metropolitana Torino AmministrazioneSindacoOscarino Ferrero (lista civica di centro-sinistra) dal 14-6-2009 TerritorioCoordinate45°23′19.17″N 7°51′59.47″E / 45.388657°N 7.86652°E45.388657; 7.86652 (Romano Canavese)Coordinate: 45°23′19.17″N 7°51′59.47″E / 45.388657°N 7.86652°E45.388657; 7.86652 (Romano...
Esta página cita fontes, mas que não cobrem todo o conteúdo. Ajude a inserir referências. Conteúdo não verificável pode ser removido.—Encontre fontes: ABW • CAPES • Google (N • L • A) (Fevereiro de 2023) Santa Maria Bertilla Boscardin Maria Bertilla Boscardin Nascimento 6 de outubro de 1888Brendola, Itália(ex-Reino da Itália) Morte 20 de outubro de 1922 (34 anos)Treviso, Itália Nome de nascimento Anna France...
+44 redirects here. For the band, see +44 (band). Telephone numbers in United KingdomTelephone Dialling Codes in the United KingdomLocationCountryUnited KingdomContinentEuropeRegulatorOfcomTypeOpenNSN length7, 9, 10[notes 1]Formatvarious, see textNumbering planThe National Telephone Numbering PlanLast updated18 September 2010Access codesCountry code44International access00Long-distance0List of United Kingdom dialing codes In the United Kingdom, telephone numbers are administered by th...
American baseball player, coach, and manager (1868–1959) Baseball player Boileryard ClarkeCatcher / First basemanBorn: (1868-10-18)October 18, 1868New York City, New York, U.S.Died: July 29, 1959(1959-07-29) (aged 90)Princeton, New Jersey, U.S.Batted: RightThrew: RightMLB debutMay 1, 1893, for the Baltimore OriolesLast MLB appearanceOctober 7, 1905, for the New York GiantsMLB statisticsBatting average.256Home runs20Runs batted in429 Teams Baltimore Orioles...
Página de El Gráfico sobre Alcok y Brown en 1919. Los aviadores británicos John Alcock y Arthur Brown realizaron el primer vuelo transatlántico sin escalas en junio de 1919.[1] Volaron en un bombardero de la Primera Guerra Mundial Vickers Vimy modificado,[2] desde San Juan, Terranova (Canadá) hasta Clifden, Connemara, condado de Galway (Irlanda).[3] El secretario de Estado del Aire, Winston Churchill, los había presentado al concurso organizado por el diario londine...
Oldest and highest honor of the Kingdom of the Netherlands Military William OrderMilitaire Willems-Orde Knight Military William Order 4th class medal (post 2000 model)Awarded by King of the NetherlandsTypeChivalric order with four degreesEstablished30 April 1815CountryNetherlandsMottoVoor Moed, Beleid en Trouw (For Bravery, Leadership and Loyalty)Awarded forPerforming acts of excellent Bravery, Leadership and Loyalty in battle.StatusCurrently constitutedGrand MasterKing Willem-AlexanderChance...
Latin Catholic bishop (b. 1963) His Excellency, The Most ReverendJoseph Mark SiegelBishop of EvansvilleSeeDiocese of EvansvilleAppointedOctober 18, 2017InstalledDecember 15, 2017PredecessorCharles C. ThompsonOrdersOrdinationJune 4, 1988by Joseph Leopold ImeschConsecrationJanuary 19, 2010by J. Peter Sartain, Joseph Leopold Imesch and Frank Joseph DewanePersonal detailsBorn (1963-07-18) July 18, 1963 (age 60)Joliet, Illinois, USADenominationCatholic ChurchParentsFrancis and Marie...
Peta pembagian administratif tingkat pertama Makedonia Utara Pembagian administratif Makedonia Utara terdiri atas 75 munisipalitas pada tingkat pertama. Makedonia Utara juga memiliki pembagian berdasarkan 8 region untuk keperluan statistik. lbsPembagian administratif EropaNegaraberdaulat Albania Andorra Armenia1 Austria Azerbaijan1 Belanda Belarus Belgia Bosnia dan Herzegovina Britania Raya Inggris Irlandia Utara Skotlandia Wales Bulgaria Ceko Denmark Estonia Finlandia Georgia1 Hungaria Repub...
Forte de São Sebastião (Angra do Heroísmo)ApresentaçãoTipo forte (en)património culturalfortalezaOcupante Pousada do Forte de São SebastiãoUso hotelEstatuto patrimonial Imóvel de Interesse PúblicoLocalizaçãoLocalização Angra (Nossa Senhora da Conceição) PortugalCoordenadas 38° 39′ 06″ N, 27° 12′ 44″ Oeditar - editar código-fonte - editar Wikidata Esta página ou seção foi marcada para revisão devido a incoerências ou dados de confiabilidade duvidosa. S...
Art museum in Paris, France Beaubourg redirects here. For other uses, see Beaubourg (disambiguation). Centre Georges PompidouGeneral informationTypeCultural centerArchitectural stylePostmodern / high-techLocationParis, FranceCompleted1971–1977Technical detailsStructural systemSteel superstructure with reinforced concrete floorsDesign and constructionArchitect(s)Renzo Piano, Richard Rogers and Gianfranco FranchiniStructural engineerArupServices engineerArupWebsitewww.centrepompidou.fr/en/ Th...
Church in Carmarthenshire, Wales Church in WalesEglwys Dewi SantLocationPicton Terrace, CarmarthenCountryWales, United KingdomDenominationAnglicanHistoryFounded1835ArchitectureHeritage designationGrade IIDesignated19 May 1981Architectural typeChurchStyleEarly nineteenth centuryClosed2003 Eglwys Dewi Sant or St David's Church, was an Anglican parish church in the town of Carmarthen, Carmarthenshire, Wales. Built in the 1830s and briefly considered as a possible replacement cathedral for the di...
Stroodorpe Buurtschap in Nederland Situering Provincie Zeeland Gemeente Terneuzen Coördinaten 51° 17′ NB, 3° 50′ OL Portaal Nederland Stroodorpe is een buurtschap in de gemeente Terneuzen in de Nederlandse provincie Zeeland. De buurtschap, in de regio Zeeuws-Vlaanderen, ligt ten zuiden van Sluiskil. Het oorspronkelijke Stroodorpe is gelegen aan de straat Stroodorpe, in de Stroodorpepolder. Soms wordt het gebied tussen de straten Stroodorpe en Eilandstraat ook tot d...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
Clothing trade show in London, England London Fashion WeekGenreFashion catwalk shows and surrounding eventsFrequencySemi-annuallyLocation(s)180 Strand, London, United KingdomInaugurated1984 (39 years)[1]AttendanceOver 5,000 press and buyersOrganised byBritish Fashion Council for the London Development Agency with help from the Department for Business, Energy and Industrial StrategyWebsitehttp://londonfashionweek.org/ London Fashion Week (LFW) is a clothing trade show that takes place ...
Market in Nigeria Balogun Market, Lagos Island Balogun Ajeniya Market is a market located on Lagos Island in Lagos State, Nigeria.[1] The market has no particular address because it sprawls across so many streets on the island. Balogun market is recognized as the best place to buy fabrics, shoes , and all sorts of wares.[2] Fire incident There have been different cases of fire incidents in the popular market, the fire occur on a different dates but the most prominent ones occu...
لمعانٍ أخرى، طالع جون جونسون (توضيح). جون جونسون معلومات شخصية الميلاد 19 يناير 1918 أركنساس سيتي الوفاة 8 أغسطس 2005 (87 سنة) شيكاغو مكان الدفن اوك وودس مقبرة [لغات أخرى] الجنسية الولايات المتحدة الأمريكية عضو في ألفا فاي ألفا [لغات أخرى]&#...
American actor, film director, and screenwriter John G. AdolfiAdolfi c. 1920Born(1888-02-19)February 19, 1888New York City, U.S.DiedMay 11, 1933(1933-05-11) (aged 45)British Columbia, CanadaOther namesJack AdolfiJohn G. AdolphiOccupationsSilent film directorActorScreenwriterYears active1907–1933 John Gustav Adolfi (February 19, 1888 – May 11, 1933) was an American silent film director, actor, and screenwriter who was involved in more than 100 productions throughout his care...
Повернення з орбітирос. Возвращение с орбиты Жанр науково-фантастичний фільм і мелодрама[d]Режисер Сурін Олександр ВолодимировичСценарист Yevgeny MesyatsevdУ головних ролях Юозас Будрайтіс, Соломін Віталій Мефодійович, Олександр Пороховщиков і Тамара АкуловаdО...
Turkish basketball player Ender ArslanArslan playing with Galatasaray in 2014.Çağdaş BodrumsporPositionHead coachLeagueBasketbol Süper LigiPersonal informationBorn (1983-01-13) 13 January 1983 (age 40)Istanbul, TurkeyNationalityTurkishListed height6 ft 2.75 in (1.90 m)Listed weight180 lb (82 kg)Career informationNBA draft2005: undraftedPlaying career2000–2021PositionPoint guardNumber13, 33, 4, 10Career historyAs player:2000–2006Efes Pilsen2006–2007Union...
«La mia città»Sencillo de Emma Marronedel álbum SchienaPublicación 9 de mayo de 2014Formato Descarga digitalGénero(s) Pop RockDuración 3:31Discográfica Universal MusicAutor(es) Emma Marrone «Trattengo il fiato» (2014) «» (2014) «Resta ancora un po'» (2012) [editar datos en Wikidata] «La mia città» (en español: «Mi ciudad») es el primer sencillo de Emma Marrone de su álbum Schiena. Fue elegido para representar a Italia el Festival de Eurovisión 2014.[1][2...
Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!