سیارک ۷۵۵۵
|
Read other articles:
This article is part of a series within thePolitics of the United Kingdom on thePolitics of Scotland The Crown The Monarch Charles III Heir apparent William, Duke of Rothesay Prerogative Royal family Succession Privy Council Union of the Crowns Balmoral Castle Holyrood Palace Scottish republicanism Executive Scottish Government Yousaf government First Minister The Rt Hon Humza Yousaf MSP Deputy First Minister Shona Robison MSP Cabinet Secretaries Junior Ministers Directorates Scottish budget ...
Опис файлу Опис Обкладинка альбому Grom гурт Behemoth Джерело Англомовна Вікіпедія Час створення 1996 Автор зображення Виконавець та / або лейбл Ліцензія див. нижче Обґрунтування добропорядного використання для статті «Grom» [?] Мета використання Проілюструвати статтю про
Legal standard of care in activity For corporate duty of care, see duty of care (business associations). Part of the common law seriesTort law (Outline) Trespass to the person Assault Battery False imprisonment Intentional infliction of emotional distress Property torts Trespass land chattels Conversion Dignitary torts Appropriation Defamation Slander Libel False light Invasion of privacy Intrusion on seclusion Breach of confidence Abuse of process Malicious prosecution Sexual torts Alienatio...
Pinkpop 2008 Algemene informatie Datum 30 mei-1 juni 2008 Locatie Megaland Landgraaf Duur 3 dagen Organisator Buro Pinkpop, Mojo Concerts Edities Eerste editie 1970 Navigatie Vorige editie 2007 Volgende editie 2009 Website Portaal Muziek Pinkpop 2008 werd gehouden op 30 en 31 mei en 1 juni 2008 op het evenemententerrein Megaland. Het was de 39e editie van het Nederlands muziekfestival Pinkpop en de 21e in Landgraaf. Het festival werd voor het eerst in de geschieden...
Late 8th-century–1215 Iranian dynasty from Ghor, modern Afghanistan Ghurid dynastybefore 786–12151203KHWARAZMIANEMPIREKIPCHAKSABBASIDCALIPHATEZENGIDSYADAVASPARA-MARASCHANDELASQOCHOQARA KHITAIKARA-KHANIDS ◁ ▷ Map of Ghurid territory, before the assassination of Muhammad of Ghor.[1][2][3] In the west, Ghurid territory extended to Nishapur and Merv,[4][5] while Ghurid troops reached as far as Gorgan on the shores of the Caspian Sea.[6][...
أوسطاثاوس معلومات شخصية الميلاد القرن 3 الوفاة القرن 4 الحياة العملية المهنة قسيس، وبطريرك اللغات الإغريقية مجال العمل إلهيات، وآريوسية تعديل مصدري - تعديل القديس أوسطاثاوس ( السريانية : ܐܣܛܐܬܘܣ ) من مدينة سيدا في ولاية بمفيلية ولد نحو سنة 25...
This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: 2021–22 Samut Prakan City F.C. season – news · newspapers · books · scholar · JSTOR (July 2021) (Learn how and when to remove this template message) Samut Prakan City 2021–22 football seasonSamut Prakan City2021–22 seasonChairmanChonsawat AsavahameManager...
Field of chemistry An enzyme (TEV protease, PDB: 1lvb) is an example of supramolecular catalysts in nature. One goal of supramolecular catalysis is to mimic active site of enzymes. Supramolecular catalysis is not a well-defined field but it generally refers to an application of supramolecular chemistry, especially molecular recognition and guest binding, toward catalysis.[1][2] This field was originally inspired by enzymatic system which, unlike classical organic chemis...
National sports team Los Pumas redirects here. For the Mexican football team, see Club Universidad Nacional. For the Mexican gridiron football team, see Pumas CU. ArgentinaNickname(s)Los Pumas (The Pumas)EmblemPumaUnionArgentine Rugby UnionHead coachMichael CheikaCaptainJulián MontoyaMost capsAgustín Creevy (106)Top scorerNicolás Sánchez (899)Top try scorerJosé María Núñez Piossek (30)Home stadiumVarious, see list First colours Second colours World Rugby rankingCurrent7 (as of 16 Octo...
District of Malaysia in KedahSik District District of MalaysiaDaerah SikOther transcription(s) • Jawiسيك • Chinese锡县 • Tamilசிக் SealLocation of Sik District in KedahSik DistrictLocation of Sik District in MalaysiaCoordinates: 5°50′N 100°45′E / 5.833°N 100.750°E / 5.833; 100.750Country MalaysiaState KedahSeatSikLocal area government(s)Sik District CouncilGovernment • District o...
Automated guideway transit systems in Singapore Light Rail Transit (LRT)A SBS Transit Mitsubishi Crystal C810 train at Punggol.OverviewNative nameSistem Rel Ringan (Malay)轻轨列车系统 (Chinese)இலகு கடவு ரயில் (Tamil)OwnerLand Transport AuthorityLocaleSingaporeTransit typeAutomated guideway transit/People mover (APM)Number of lines3Number of stations41 (excluding Teck Lee and Ten Mile Junction)Daily ridership208,000 (2019)[1]OperationBegan...
Games played through postal mail, email or other digital media Four-time Origins Award-winning play-by-mail game Starweb A play-by-mail game (also known as a PBM game, PBEM game, turn-based game, turn based distance game, or an interactive strategy game.[a]) is a game played through postal mail, email or other digital media. Correspondence chess and Go were among the first PBM games. Diplomacy has been played by mail since 1963, introducing a multi-player aspect to PBM games. Flying B...
St. George's Square, in Barrow-in-Furness, Cumbria, England is a public space that acted as the centre of the town during the late 19th century. The square now lies in the southernmost fringes of the Central ward close to the Port of Barrow. Background St. George's Square is a conservation area and is flanked by a number of listed buildings. Amongst the most notable buildings located in St. George's Square are the former headquarters of the Furness Railway and Barrow's first permanent train s...
2011 American filmBlue Crush 2DVD coverDirected byMike ElliottWritten byRandall McCormickProduced byMike ElliottStarring Sasha Jackson Elizabeth Mathis Ben Milliken Chris Fisher Gideon Emery Rosy Hodge Rodger Halston Sharni Vinson CinematographyTrevor Michael BrownEdited byRoderick DavisMusic byJ. Peter RobinsonProductioncompanyImagine EntertainmentDistributed byUniversal Studios Home EntertainmentRelease date June 7, 2011 (2011-06-07) Running time113 minutesCountryUnited State...
Agria II dari Promptuarii Iconum Insigniorum Agripa II (27 M - 100 M), anak Agripa I, (seperti ayahnya awalnya juga bernama Marcus Julius Agripa), adalah raja ketujuh dan terakhir dari keluarga Herodes Agung, sehingga terakhir dari Herodian. Saudara-saudara perempuannya bernama Bernike dan Drusila (istri kedua dari prokurator Romawi Antonius Feliks). Dia kadang-kadang juga disebut Herodes Agripa II.[1] Kehidupan Apostle Paul On Trial (Persidangan Rasul Paulus) lukisan Nikolai Bodarevs...
Sekret Machines: Gods AuthorTom DeLongePeter LevendaLanguageEnglishGenreNon-fictionPublishedMarch 7, 2017PublisherTo the StarsSimon & SchusterPages454ISBN978-1943272235Followed bySekret Machines: Man Sekret Machines: Gods (sometimes referred to as Gods, Man & War: Volume 1) is a non-fiction ufology novel created by Tom DeLonge, American musician, co-lead vocalist/guitarist of Blink-182, and Angels & Airwaves, and American occult novelist Peter Levenda. The book was co-p...
District in Badung Regency, Bali Province, Indonesia Location of North Kuta in Badung North Kuta, (Indonesian: Kecamatan Kuta Utara) is a district in Badung Regency of Bali, Indonesia. It lies just north of Kuta District and west of Denpasar city. It covers 33.86 square kilometres, and had a population of 103,775 as of 2010 Census,[1] having seen the heaviest brunt of suburbanization of all districts in the decade up to 2010 as the region was formerly mostly uninhabited fields. Howeve...
The territory of the Vestini in a 1624 map by Philip Clüver published in Italia Antiqua. Vestini country, looking inland at Gran Sasso from Pescara. Vestini (Latin: Vestīni[1]) were an Italic tribe who occupied the area of the modern Abruzzo (central Italy), included between the Gran Sasso and the northern bank of the Aterno river. Their main centres were Pitinum (near modern L'Aquila), Aufinum (Ofena), Peltuinum (Prata d'Ansidonia), Pinna (Penne) and Aternum (Pescara, shared with t...
Carmelite Roman Catholic monastery in Berdychiv, Ukraine Monastery of Discalced CarmelitesМонастир кармелітів босихLocation within Zhytomyr OblastShow map of Zhytomyr OblastBerdychiv Carmelite Monastery (Ukraine)Show map of UkraineMonastery informationOrderDiscalced CarmelitesDenominationLatin ChurchEstablished1630DioceseRoman Catholic Diocese of Kyiv-ZhytomyrPeopleFounder(s)Janusz Tyszkiewicz ŁohojskiArchitectureHeritage designation105StyleBaroqueCompletion date1842Si...
Campionato europeo Under-18 2017 Competizione Campionato europeo Under-18 Sport Pallavolo Edizione XII Organizzatore CEV Date dal 1º aprile 2017al 9 aprile 2017 Luogo Paesi Bassi Partecipanti 12 Impianto/i Vedi elenco Risultati Vincitore Russia(3º titolo) Secondo Italia Terzo Bielorussia Statistiche Miglior giocatore Terry Enweonwu Incontri disputati 38 Cronologia della competizione 2015 2018 Manuale Il campionato europeo di pallavolo femminile Under-18 2017 si è sv...