This article is about a regional state in Ethiopia. For historical context about this region, see Ogaden. For all the combined regions inhabited by ethnic Somalis, see Greater Somalia.
The Somali Region (Somali: Deegaanka Soomaalida, Amharic: ሱማሌ ክልል, romanized: Sumalē Kilil, Oromo: Naannoo somaalee, Arabic: المنطقة الصومالية), also known as Soomaali Galbeed (lit.'Western Somalia')[3] and officially the Somali Regional State, is a regional state in eastern Ethiopia. Its territory is the largest after Oromia Region.[4] The regional state borders the Ethiopian regions of Afar and Oromia and the chartered city Dire Dawa to the west, as well as Djibouti to the north, Somalia to the northeast, east and south; and Kenya to the southwest.[5]
Jijiga is the capital of the Somali Region. The capital was formerly Gode, until Jijiga became the capital in 1995 on account of political considerations.[6]
The Somali regional government is composed of the executive branch, led by the President; the legislative branch, which comprises the State Council; and the judicial branch, which is led by the State Supreme Court.
Overview
What is now the Somali Region was part of the conquests of Menelik II in the late 19th century.
The Somali Region formed a large part of the pre-1995 provinces of Hararghe, Bale and Sidamo. The population is predominantly Somali, and there have been attempts to incorporate the area into a Greater Somalia. In the 1977, Somalia invaded Ethiopia, igniting the Ogaden War, which Somalia lost due to timely military intervention from the Soviet Union and its ally Cuba. Despite this defeat, local groups still tried either to become part of Somalia or independent.[citation needed][7]
Until its first-ever district elections in February 2004, Zonal and woreda administrators and village chairmen were appointed by the Regional government. Senior politicians at the Regional level nominated their clients to the local government positions. In the 2004 local elections, each woreda elected a council including a spokesman, vice-spokesman, administrator, and vice-administrator. These councils have the responsibility of managing budgets and development activities within their respective districts.[8]
Demographics
Based on the 2007 Census conducted by the Central Statistical Agency of Ethiopia (CSA), the Somali Region has a total population of 4,439,147, consisting of 2,468,784 men and 1,970,363 women; urban residents numbered 621,210 or 14% of the population, while rural residents numbered 3,817,937.[9] With an estimated area of 327,068 square kilometers, this region has an estimated density of 20.9 people per square kilometer. For the entire region 1, 685,986 households were counted, which results in an average for the Region of 6.8 persons to a household, with urban households having on average 6 and rural households 6.5 people.
There are 8 refugee camps and 1 transit center, housing 212,967 refugees from Somalia, located in Somali Region.[5]
In the previous census, conducted in 1994, the region's population was reported to be 3,383,165, of which Somalis made up 3,236,667. There were 1,846,417 were males and 1,537,748 were females. The urban residents of the Somali Region numbered 492,710 households, with an average of 6.6 persons per household; a high sex ratio of 120 males to 100 females was reported.[10] As of 1997, the ethnic composition of the Region was 95.67% Somali, 0.70% Amhara, 2.25% Oromo; all other ethnic groups made up 1.38% of the population.[11]
According to the CSA, as of 2004[update], 38.98% of the total population had access to safe drinking water, of whom 21.32% were rural inhabitants and 77.21% were urban.[12] Values for other reported common indicators of the standard of living for Somali as of 2005[update] include the following: 71.8% of the inhabitants fall into the lowest wealth quintile; adult literacy for men is 22% and for women 9.8%; and the Regional infant mortality rate is 57 infant deaths per 1,000 live births, which is less than the nationwide average of 77; at least half of these deaths occurred in the infants’ first month of life.[13]
Various subclans of the Darod clan family primarily inhabit the central and eastern parts of the region, with the Ogaden and Jidwaq inhabiting the interior as well as the major towns of Jijiga, Gode, Kebridehar. The Harti as well as the Leelkase clans inhabit the Dollo zone where they make up the majority while the Marehan clan inhabit the Shilavo woreda and the Liben zone.[14]
Languages
Somali as a primary language is spoken by 95.89% of the inhabitants. All other languages spoken together make up 4.11%.[17][18]
Religion
98.74% of the population are Muslim, All other religions together made up 1.26%.[19][20][21]
Agriculture
The CSA of Ethiopia estimated in 2005 that farmers in the Somali Region had a total of 1,459,720 cattle (representing 10.19%% of Ethiopia's total cattle), 1,463,000 sheep (20.66%), 1,650,970 goats (50.02%), 1,291,550 donkeys (30.66%), 5,3165,260 camels (96.2%), 154,670 poultry of all species (0.5%), and 5,330 beehives (0.12%). For nomadic inhabitants, the CSA provided two sets of estimates, one based on aerial surveys and the other on more conventional methodology:[22]
The executive branch is headed by the Chief Administrator of Somali Regional State. The current Chief Administrator is Mustafa Muhummed Omer (Cagjar), elected on 22 August 2018.[23] A Vice President of Somali Region succeeds the president in the event of any removal from office, and performs any duties assigned by the president. The current vice president is Adam Farah Ibrahim. The other offices in the executive branch cabinet are the Regional Health Bureau, Educational Bureau, and 18 other officials.[24]
There are three levels of the Somali region judiciary. The lowest level is the court of common pleas: each woreda maintains its own constitutionally mandated court of common pleas, which maintain jurisdiction over all justiciable matters. The intermediate-level court system is the district court system. Four courts of appeals exist, each retaining jurisdiction over appeals from common pleas, municipal, and county courts in an administrative zone. A case heard in this system is decided by a three-judge panel, and each judge is elected.
The highest-ranking court, the Somali Supreme Court, is Somali's "court of last resort". A Seven-justice panel composes the court, which, by its own discretion, hears appeals from the courts of appeals, and retains original jurisdiction over limited matters. The chief judge is called the Chief of Soamli Supreme Court Abdullahi Saed Omar. [30]
Legislative branch
The State Council, which is the highest administrative body of the state, is made up of 269 members.[31]
^1994 Population and Housing Census of Ethiopia: Results for Somali Region, Vol. 1] "Archived copy"(PDF). Archived from the original on 2008-11-19. Retrieved 2009-03-23.{{cite web}}: CS1 maint: archived copy as title (link) CS1 maint: bot: original URL status unknown (link) Tables 2.4, 2.14 (accessed 10 January 2009).
^"Sociology Ethnology Bulletin". 1994. Archived from the original on 19 February 2022. Retrieved 23 August 2021. Different aid groups were also set up to help communities cope in the predominantly Gadabursi district of Aw Bare.
^1994 Population and Housing Census of Ethiopia: Results for Somali Region, Vol. 1] "Archived copy"(PDF). Archived from the original on 2008-11-19. Retrieved 2009-03-23.{{cite web}}: CS1 maint: archived copy as title (link) CS1 maint: bot: original URL status unknown (link) Tables 2.4, 2.14 (accessed 10 January 2009).
^1994 Population and Housing Census of Ethiopia: Results for Somali Region, Vol. 1] "Archived copy"(PDF). Archived from the original on 2008-11-19. Retrieved 2009-03-23.{{cite web}}: CS1 maint: archived copy as title (link) CS1 maint: bot: original URL status unknown (link) Tables 2.4, 2.14 (accessed 10 January 2009).
Tobias Hagmann, "Beyond clannishness and colonialism: understanding political disorder in Ethiopia's Somali Region, 1991- 2004", Journal of Modern African Studies, 43 (2005), 509–536.
Abdi Ismail Samatar (2004): "Ethiopian Federalism: Autonomy versus Control in the Somali Region". Third World Quarterly, Vol. 25/6
John Markakis (1996): "The Somali in Ethiopia". Review of African Political Economy, Vol. 23, No. 70, pp. 567–570
John Markakis (1994): "Briefing: Somalia in the New Political Order of Ethiopia". Review of African Political Economy, Vol. 21, No. 59 pp. 71–79
Pour les articles homonymes, voir Giovanni Battista Pozzi et Pozzi. Giovanni Battista PozziNaissance 1561ValsoldaDécès 1589RomeActivité Artiste visuelLieu de travail Romemodifier - modifier le code - modifier Wikidata Giovanni Battista Pozzi, né vers 1560 à Milan ou en 1561 à Valsolda, et mort en 1589 à Rome, est un peintre italien. Biographie Selon Baglione, il est né vers 1560 à Milan[1]. D'après le Bénézit, il est né en 1561 à Valsolda et les détails sur les antécédents ou...
St. Michael in Dormagen Inneres St. Michael ist die römisch-katholische Pfarrkirche der Stadt Dormagen im Rhein-Kreis Neuss. Sie geht im Kern bis in das 12. Jahrhundert zurück. Geschichte Die ursprünglich romanische Kirche wurde im 12. Jahrhundert aufgeführt. 1274 wurde sie dem Kölner Andreasstift inkorporiert. Das Langhaus wurde in gotischer Zeit durch einen Neubau ersetzt; der aus Tuffstein gemauerte romanische Turm blieb erhalten. 1887 wurde das gotische Langhaus niedergelegt – sein...
Eugène Brieux. Jean Jules Jusserand dan Eugène Brieux (1914). Eugène Brieux (bahasa Prancis: [bʁjø]; 19 Januari 1858 – 6 Desember 1932) adalah pembuat drama Prancis kelahiran Prancis dari orang tua miskin. Drama buatannya berjudul Bernard Palissy, ditulis dalam kolaborasi dengan M. Gaston Salandri, diproduksi pada 1879, namun ia menunggu sebelas tahun sebelum ia mendengar yang lainnya. Ménage d'artistes buatannya diproduksi oleh Antoine di Théâtre Libre pada 1890....
Inca KolaJenisMinuman ringanProdusenCorporación José R. Lindley S.A.Negara asalPeruDiperkenalkan1935Produk terkaitCoca-Cola, Kola RealInca Kola (juga dikenal sebagai Kola Emas/Golden Kola pada iklan internasional)[1] adalah minuman ringan yang diciptakan di Peru pada 1935 oleh imigran asal Inggris Joseph Robinson Lindley.[2] Minuman soda ini rasanya manis, memiliki rasa buah yang merepresentasikan bahan utamannya yaitu lemon verbena (verbena de Indias or cedrón dalam bahasa...
Neighborhood in Hennepin, Minnesota, United StatesNorth Loop Market Square, Market DistrictNeighborhoodNickname: The Warehouse DistrictLocation of North Loop within the U.S. city of MinneapolisCountryUnited StatesStateMinnesotaCountyHennepinCityMinneapolisCommunityCentralArea[1] • Total0.837 sq mi (2.17 km2)Population (2020)[2] • Total7,540 • Density9,000/sq mi (3,500/km2)Time zoneUTC-6 (CST) • Summe...
Para penari Tari Remo Tari Remo adalah salah satu tarian untuk penyambutan tamu yang ditampilkan baik oleh satu atau lebih, Remo berasal dari kata Reyoge Cak Mo. Tarian ini berasal dari Jombang, Provinsi Jawa Timur. Asal usul Tari Remo menggunakan properti Jathilan Ponorogo Tari Remo berasal dari Kabupaten Jombang, Jawa Timur. Tarian ini diciptakan oleh seniman Jombang yang dikenal dengan Cak Mo yang pernah menjadi Gemblak dari sebuah Grup Reog di Ponorogo. karena kemarau yang panjang membuat...
New Zealand Fire ServiceWhakaratonga Iwi (Māori)Operational areaCountryNew ZealandAgency overviewEstablished1 April 1976 (1 April 1976)Dissolved30 June 2017 (30 June 2017) (replaced by Fire and Emergency New Zealand)Annual calls74,879 (2015–16)[1]Employees1,700 career firefighters[1]8,300 urban volunteer firefighters[1]Staffing585 management and support76 communications centreFire chiefPaul McGill (National Commander)MottoLeading integrated fire and emerge...
Este artículo o sección tiene referencias, pero necesita más para complementar su verificabilidad.Puedes avisar al redactor principal pegando lo siguiente en su página de discusión: {{sust:Aviso referencias|Gaku Shibasaki}} ~~~~Este aviso fue puesto el 12 de octubre de 2023. Gaku Shibasaki Datos personalesNombre completo 柴崎 岳 (kanji)しばさき がく (hiragana)シバサキ ガク (katakana)Nacimiento Noheji, Aomori28 de mayo de 1992 (31 años)País JapónNacionalidad(es...
Indian dynasty (1st century BCE–3rd century CE) Chutu dynasty1st century BCE–3rd century CE Coin of the Chutu ruler Mulananda c. 125-345. Lead Karshapana 14.30g. 27 mm. Obv.: Arched hill/stupa with river motif below. Rev.: Tree within railed lattice, triratana to right. South Asia125 CESAMATATASSATAVAHANASMAHAMEGHA-VAHANASPANDYASAYCHOLASCHERASCHUTUSKUSHAN EMPIREPARATARAJASNORTHERNSATRAPSHAN DYNASTYWESTERNSATRAPSMALAVASYAUDHEYASINDO-PARTHIANS ◁ ▷ class=notpageimage| Location of th...
Not to be confused with Ontario–East station. For train stations in Ontario, Canada, served by Amtrak, see Maple Leaf (train) § Station stops. Ontario, CAThe Sunset Limited at Ontario station in March 1995General informationLocation198 East Emporia StreetOntario, CaliforniaUnited StatesCoordinates34°03′42″N 117°38′59″W / 34.0617°N 117.6496°W / 34.0617; -117.6496Line(s)Union Pacific Railroad Alhambra SubdivisionPlatforms1 side platformTracks2Other in...
Taylor Mill State Historic SiteTaylor MillTaylor MillLocation in New HampshireLocationDerry, New Hampshire, United StatesCoordinates42°52′32″N 71°14′21″W / 42.875603°N 71.239217°W / 42.875603; -71.239217Elevation269 feet (82 m)[1]Administered byNew Hampshire Division of Parks and Recreation & New Hampshire Division of Forests and LandsDesignationNew Hampshire state parkWebsiteTaylor Mill Historic Site The Taylor Mill State Historic Sit...
Tori Amos discographyPerforming at the Glastonbury festival in 2005Studio albums16Live albums2Compilation albums3Video albums8Music videos28EPs6Singles40B-sides69Soundtrack albums12Tribute albums2Official bootlegs33Other contributions5Side projects8 Tori Amos is an American pianist and singer-songwriter whose musical career began in 1980, at the age of seventeen, when she and her brother co-wrote the song Baltimore. The song was selected as the winning song in a contest for the Baltimore Orio...
Census Town in West Bengal, IndiaKachu PukurCensus TownKachu PukurLocation in West Bengal, IndiaShow map of West BengalKachu PukurKachu Pukur (India)Show map of IndiaCoordinates: 25°00′N 88°16′E / 25.00°N 88.27°E / 25.00; 88.27Country IndiaStateWest BengalDistrictMaldaArea • Total0.81 km2 (0.31 sq mi)Population (2011) • Total5,752 • Density7,100/km2 (18,000/sq mi)Languages • OfficialB...
Maze Runner: The Scorch TrialsTítulo El corredor del laberinto: Las pruebas (España)Maze Runner: Prueba de fuego (Hispanoamérica)Ficha técnicaDirección Wes BallProducción Ellen Goldsmith-VeinMarty BowenWyck GodfreyLee StollmanGuion T.S. NowlinBasada en The Scorch Trials de James DashnerMúsica John PaesanoFotografía Gyula PadosMontaje Dan ZimmermanProtagonistas Ver repartoDylan O'BrienKaya ScodelarioThomas Brodie-SangsterDexter DardenNathalie EmmanuelGiancarlo EspositoAlexander FloresA...
Río Grande de Tárcoles Vista desde las cercanías de CararaUbicación geográficaCuenca Gran Área Metropolitana;Región central de PuntarenasNacimiento Cordillera Volcánica CentralDesembocadura Océano Pacífico (cantón de Garabito, provincia de Puntarenas)Coordenadas 9°47′11″N 84°38′28″O / 9.7863138888889, -84.641175Ubicación administrativaPaís Costa Rica Costa RicaCuerpo de aguaLongitud 111 kmSuperficie de cuenca 2.121 km²[editar datos en Wikidata...
Кавказские этнические меньшинства в Турции — различные национальные меньшинства Турции, имеющие кавказское происхождение. Содержание 1 Общая информация 2 Численность 3 См. также 4 Примечания 5 Ссылки Общая информация Основные статьи: Черкесы в Турции, Осетины в Турции...
Castle in Turkey Foça Castle (Turkish: Foça Kalesi), also known as Beşkapılar Castle (Turkish: Beşkapılar Kalesi), is a coastal fortification in İzmir Province, western Turkey. The castle is located in Foça ilçe (district) of İzmir Province at 38°40′08″N 26°45′03″E / 38.66889°N 26.75083°E / 38.66889; 26.75083. Its distance to İzmir is about 55 kilometres (34 mi). The fortification wall around the ancient city of Phocaea was built in 590-580 ...
The sack of Thessalonica in 904, from the Madrid Skylitzes. John Kaminiates (Greek: Ιωάννης Καμινιάτης, fl. tenth century) was a Greek resident of Thessalonica when the city, then one of the largest in the Byzantine Empire, was besieged and sacked by a Saracen force led by Leo of Tripoli in 904. His account of the city's plunder, On the capture of Thessalonica, (Εις την άλωσιν της Θεσσαλονίκης, Eis tēn alōsin tēs Thessalonikēs) survives in four ...