Patrick Lincoln

Patrick Lincoln
Born1964
Alma materMassachusetts Institute of Technology
Stanford University
Known forComputer Security, Formal verification, Computational Biology, Nanotechnology
AwardsSRI International Fellow 2005
Scientific career
FieldsComputer Science
InstitutionsSRI International
Doctoral advisorJohn Mitchell

Patrick Denis Lincoln (born 1964) is an American computer scientist leading the Computer Science Laboratory (CSL) at SRI International. Educated at MIT and then Stanford, he joined SRI in 1989 and became director of the CSL around 1998. He previously held positions with ETA Systems, Los Alamos National Laboratory, and MCC.

Education and early career

Lincoln received a bachelor of science in electrical engineering and computer science from the Massachusetts Institute of Technology in 1986, with the thesis "DisCoRd distributed combinator reduction, automatic parallelizing compiler" under thesis advisor Rishiyur Nikhil.[1] While pursuing that degree, he held a position in ETA Systems' Software Division from 1982 to 1983; one at Los Alamos National Laboratory, Division C-10 from 1984 to 1985. After graduation, he held a position with MCC from 1986 to 1988 in their Software Technology and Advanced Computer Architecture departments.[1]

Lincoln then attended Stanford University, from 1988 to 1992, earning a Ph.D. in computer science under advisor John Mitchell. Lincoln's doctoral dissertation was "Computational aspects of linear logic".[1][2][3]

Later career

In 1989, Lincoln joined SRI International's Computer Science Laboratory (CSL). He is the director of SRI's Computer Science Laboratory since 1998 and became Vice-President of Information and Computing Sciences in 2018.[4] He is also the executive director of SRI's program for the Department of Homeland Security's Cyber Security Research and Development Center and co-director of the SRI Center for Computational Biology.[5] He also leads numerous multidisciplinary research groups.[6][7]

In 2013, he was featured in the BBC Horizon episode "Defeating the Hackers" [8] and NOVA episode "Rise of the Hackers" [9] describing his work on secure computing and cortical cryptography. This is focusing on how to store a password in someone's mind that they cannot directly recall; for example, by teaching them to play a song and measuring their reaction times.[10][11] Those methods are theoretically resistant to rubber-hose cryptanalysis, where a user is coerced to give up a password or other key; if you don't know a password, you can't tell it to someone.[12]

Advisory boards and awards

He has served on the Defense Science Board task force on Science and Technology and of the Defense Science Board task force on Defensive Information Operations. He is serving on several advisory boards, including startups such as Neurome,[13] Relational.AI,[14] Blackhorse.

In 2005, Lincoln was named an SRI Fellow.[15] In 2013, he and collaborators received the Best Paper Award at The 19th IEEE Pacific Rim International Symposium on Dependable Computing (PRDC).[16]

Selected publications

Patrick Lincoln holds over 240 scientific publications. He is amongst the computer scientists whose publications' h-index is above 50 [17]

  • bRIGHT–Workstations of the Future and Leveraging Contextual Models, R Senanayake, G Denker, P Lincoln, International Conference on Human Interface and the Management of Information, 2018
  • Model, data and reward repair: Trusted machine learning for Markov Decision Processes, S Ghosh, S Jha, A Tiwari, P Lincoln, X Zhu, 48th Annual IEEE/IFIP International Conference on Dependable Systems, 2018
  • Probabilistic Modeling of Failure Dependencies Using Markov Logic Networks S Ghosh, W Steiner, G Denker, P Lincoln, Proceedings of the 19th IEEE Pacific Rim International Symposium on Dependable Computing (PRDC), 2013. (Best Paper Award)
  • Neuroscience meets cryptography: designing crypto primitives secure against rubber hose attacks, H Bojinov, D Sanchez, P Reber, D Boneh, P Lincoln, Proceedings of the 21st USENIX conference on Security symposium, 33-33, 2012
  • {TRIST}: Circumventing Censorship with Transcoding-Resistant Image Steganography, C Connolly, P Lincoln, I Mason, V Yegneswaran, 4th {USENIX} Workshop on Free and Open Communications on the Internet ({FOCI} 14), 2014
  • Bootstrapping Communications into an Anti-Censorship System, P Lincoln, I Mason, P Porras, V Yegneswaran, Z Weinberg, J Massar, W A Simpson, P Vixie, D Boneh, 2nd USENIX Workshop on Free and Open Communications on the Internet, 2012
  • Dynamic LDPC codes for nanoscale memory with varying fault arrival rates, S Gosh, P Lincoln, Design & Technology of Integrated Systems in Nanoscale Era (DTIS), 2011 6th International Conference on, vol., no., pp. 1,4, 2011
  • Markov logic networks in health informatics, S Ghosh, P Lincoln, N Shankar, S Owre, S David, G Swan, Proceedings of ICML-MLGC, 2011
  • Homogeneity as an advantage: It takes a community to protect an application, L Briesemeister, S Dawson, P Lincoln, H Saidi, J Thornton, G Durfee, P Kwan, E Stinson, A Oliner, J Mitchell, CollSec'10 Proceedings of the 2010 international conference on Collaborative methods for security and privacy, 2010
  • Challenges in scalable fault tolerance, P Lincoln, Nanoscale Architectures, NANOARCH'09. IEEE/ACM International Symposium on Nanoscale Architectures, 2009
  • Non-photolithographic nanoscale memory density prospects, A DeHon, S C Goldstein, P J Kuekes, P Lincoln, IEEE Transactions on Nanotechnology 4 (2), 215-228 2005 cited 117
  • Unification and narrowing in Maude 2.4, M Clavel, F Durán, S Eker, S Escobar, P Lincoln, N Martí-Oliet, J Meseguer, C Talcott, Rewriting Techniques and Applications, 380-390 2009
  • Early indicators of exposure to biological threat agents using host gene profiles in peripheral blood mononuclear cells, R Das, R Hammamieh, R Neill, GV Ludwig, S Eker, P Lincoln, P Ramamoorthy, A ..., BMC Infectious Diseases 8 (1), 2008
  • Maude: Specification and programming in rewriting logic, M Clavel, F Durán, S Eker, P Lincoln, N Martı-Oliet, J Meseguer, JF Quesada, Theoretical Computer Science 285 (2), 187-243, 2002 cited 980
  • Architectural support for copy and tamper resistant software, D Lie, C Thekkath, M Mitchell, P Lincoln, D Boneh, J Mitchell, M Horowitz, ACM SIGPLAN Notices 35 (11), 168-177, 2000 cited 852
  • Using Maude, M Clavel, F Durán, S Eker, P Lincoln, N Martí-Oliet, J Meseguer, JF Quesada, Fundamental Approaches to Software Engineering, 371-374, 2000 cited 400
  • A meta-notation for protocol analysis, I Cervesato, NA Durgin, PD Lincoln, JC Mitchell, A Scedrov, Computer Security Foundations Workshop, 1999. Proceedings of the 12th IEEE ..., 1999 cited 344
  • Principles of maude, M Clavel, S Eker, P Lincoln, J Meseguer, Electronic Notes in Theoretical Computer Science 4, 65-89, 1996 cited 294
  • Undecidability of bounded security protocols, NA Durgin, PD Lincoln, JC Mitchell, A Scedrov, In Workshop on Formal Methods and Security Protocols, 1999, cited 345
  • The maude 2.0 system, M Clavel, F Durán, S Eker, P Lincoln, N Martí-Oliet, J Meseguer, C Talcott, Rewriting Techniques and Applications, 76-87, 2003 cited 370
  • Efficient implementation of lattice operations, H Aït-Kaci, R Boyer, P Lincoln, R Nasr, ACM Transactions on Programming Languages and Systems 11 (1), 115-146, 1989 cited 310
  • All about maude-a high-performance logical framework: how to specify, program and verify systems in rewriting logic, M Clavel, F Durán, S Eker, P Lincoln, N Martí-Oliet, J Meseguer, C Talcott, Springer-Verlag, 2007 cited 1235
  • A probabilistic poly-time framework for protocol analysis, P Lincoln, J Mitchell, M Mitchell, A Scedrov, Proceedings of the 5th ACM conference on Computer and communications ... 1998, cited 246
  • Decision problems for propositional linear logic, P Lincoln, J Mitchell, A Scedrov, N Shankar, Annals of pure and applied logic 56 (1), 239-311, 1992 cited 322
  • Stochastic assembly of sublithographic nanoscale interfaces, A DeHon, P Lincoln, JE Savage, IEEE Transactions on Nanotechnology 2 (3), 165-174, 2003 cited 246
  • Epidemic Profiles and Defense of Scale-Free Networks, L Briesemeister, P Lincoln, P Porras, Proceedings of 2003 ACM Workshop on Rapid Malcode, 67-75, 2003 cited 107
  • All About Maude-A High-Performance Logical Framework, How to Specify, Program and Verify Systems in Rewriting Logic, volume 4350 of Lecture Notes in Computer Science, M Clavel, F Durán, S Eker, P Lincoln, N Martı-Oliet, J Meseguer, CL Talcott, Springer 4, 50-88, 2007 cited 205
  • Pathway logic: Symbolic analysis of biological signaling, S Eker, M Knapp, K Laderoute, P Lincoln, J Meseguer, K Sonmez, Pacific symposium on Biocomputing 7, 400-412, 2002 cited 195
  • Multiset rewriting and the complexity of bounded security protocols, N Durgin, P Lincoln, J Mitchell, A Scedrov, Journal of Computer Security 12 (2), 247-311, 2004 cited 194
  • Maude manual (version 2.6), M Clavel, F Durán, S Eker, P Lincoln, N Martı-Oliet, J Meseguer, C Talcott, University of Illinois, Urbana-Champaign 1 (3), 4.6, 2011 cited 204
  • A formally verified algorithm for interactive consistency under a hybrid fault model, P Lincoln, J Rushby, Fault-Tolerant Computing, 1993. FTCS-23. Digest of Papers., 1993. Also appears in FTCS: Highlights from 25 Years, 1995, pp. 438–447 cited 128
  • On Shostak's decision procedure for combinations of theories, D Cyrluk, P Lincoln, N Shankar, Automated Deduction—CADE-13, 463-477, 1996 cited 109
  • Privacy-preserving sharing and correction of security alerts, P Lincoln, P Porras, V Shmatikov, Proceedings of the 13th conference on USENIX Security Symposium-Volume 13, 17-17, 2004 cited 136

Patents

Dr. Lincoln holds more than 40 patents in varied fields, including computer security, high-assurance systems, advanced user interfaces, computer networking, robotics, biotechnology, and nanotechnology. A selected subset is listed below.

Computer and Information Security
  • Visually intuitive interactive network cyber defense, R Senanayake, PA Porras, PD Lincoln, US Patent App. 14/733,899, 2016
  • Method, System and Device for Inferring a Mobile User's Current Context and Proactively Providing Assistance, K C Nitz, P D Lincoln, K L Myers, H H Bui, R Senanayake, G Denker, W Mark, N D Winarsky, S S Weiner, US Patent 13585003, 2014
  • {TRIST}: Circumventing Censorship with Transcoding-Resistant Image Steganography, C Connolly, P Lincoln, I Mason, V Yegneswaran, 4th {USENIX} Workshop on Free and Open Communications on the Internet ({FOCI} 14), 2014
  • System and method for authenticating a manufactured product with a mobile device, SM Eker, PD Lincoln, US Patent 8,534,543, 2013 and US Patent 8,534,544, 2013
  • System and method using information based indicia for securing and authenticating transactions, PD Lincoln, N Shankar, US Patent 7,117,363, 2006 and US Patent 8,171,297, 2012
  • Lattice-based security classification system and method, PD Lincoln, SM Dawson, P Samarati, SDC di Vimercati, US Patent 6,922,696, 2005
High-Assurance Systems
  • Formal methods for modeling and analysis of hybrid systems, A Tiwari, PD Lincoln, US Patent 7,574,334, 2009
Advanced Collaborative Multimodal User Interfaces
  • Adaptable actuated input device with integrated proximity detection, R Senanayake, G Denker, PD Lincoln, J Murray, SS Weiner, US Patent 20,130,215,038, 2013
  • Method for adaptive interaction with a legacy software application, R Senanayake, G Denker, PD Lincoln, J Murray, SS Weiner, US Patent 20,130,215,005, 2013
  • Adaptable input/output device, R Senanayake, G Denker, PD Lincoln, RD Kornbluh, SJ Lincoln, RP Heydt, H ..., US Patent 20,120,313,857 2012 and US Patent 20,120,313,854, 2012
Computer Networking
  • Method and apparatus for processing network packets, PD Lincoln, SM Eker, US Patent 7,706,378, 2010
  • Methods and apparatus for scalable, distributed management of virtual private networks, DWJ Stringer-Calvert, SM Dawson, PD Lincoln, US Patent 7,403,980, 2008
  • Method and apparatus for providing scalable resource discovery, DWJ Stringer-Calvert, PD Lincoln, SM Dawson, US Patent 7,177,867, 2007
  • Method and apparatus for generating, distributing and reconstructing deconstructed video, PD Lincoln, DWJ Stringer-Calvert, SM Dawson, US Patent 7,095,444, 2006
Robotics
  • Wall crawling robots, RE Pelrine, H Prahlad, RD Kornbluh, PD Lincoln, S Stanford, US Patent 7,554,787, 2009, US Patent 7,554,784, 2009, and US Patent 8,111,500, 2012
Biotechnology
  • Nanoscale array biomolecular bond enhancer device, PD Lincoln, US Patent App. 12/215,239, 2008, and US Patent 7,985,385, 2011
  • Modeling and evaluation metabolic reaction pathways and culturing cells, SM Eker, PD Lincoln, PD Karp, P Romero, US Patent 7,308,363, 2007
  • Biopolymer sequence comparison, LR Toll, PD Lincoln, PD Karp, K Sonmez, US Patent 7,133,781, 2006
  • Data relationship model, K Sonmez, LR Toll, PD Lincoln, PD Karp, US Patent 7,039,238, 2006
  • Method and apparatus for classifying nucleic acid responses to infectious agents, PD Lincoln, SM Eker, US Patent App. 11/335,982, 2006
  • Method and apparatus for real-time correlation of data collected from biological sensors, PD Lincoln, ADJ Valdes, PA Porras, US Patent App. 11/073,257, 2005
Nanotechnology
  • Nanoscale volumetric imaging device having at least one microscale device for electrically coupling at least one addressable array to a data processing means, PD Lincoln, CM Patton, US Patent 7,683,303, 2010
  • Sublithographic nanoscale memory architecture, A Dehon, CM Lieber, PD Lincoln, J Savage, US Patent 6,963,077, 2005 and EP Patent 1,525,586, 2007
  • Nanoscale selection circuit, A Dehon, PD Lincoln, CM Lieber, J Savage, EP Patent 1,758,126, 2007
  • Stochastic assembly of sublithographic nanoscale interfaces, A DeHon, CM Lieber, PD Lincoln, JE Savage, US Patent 6,900,479, 2005 and EP Patent 1,525,585, 2005
  • Three-dimensional memory array, A Dehon, PD Lincoln, CM Lieber, J Savage, EP Patent 1,630,819, 2009

References

  1. ^ a b c "Patrick Lincoln". SRI International Computer Science Laboratory. Retrieved 2014-01-12.
  2. ^ "Advising Genealogy of Patrick Lincoln". SRI International Computer Science Laboratory. Retrieved 2013-01-12.
  3. ^ "Patrick Dennis Lincoln". Mathematics Genealogy Project. North Dakota State University. Retrieved 2014-01-12.
  4. ^ "Patrick Lincoln, Director, Computer Science Laboratory | SRI International". www.sri.com. Retrieved 2019-08-04.
  5. ^ "formation of SRI's Center of Excellence in Computational Biology | SRI International". www.sri.com. Retrieved 2019-08-04.
  6. ^ "SRI Computer Science Laboratory". SRI International.
  7. ^ "Computer Science Laboratory". www.csl.sri.com. Retrieved 2019-08-04.
  8. ^ "Horizon - Defeating the Hackers". computer-literacy-project.pilots.bbcconnectedstudio.co.uk. Retrieved 2019-08-04.
  9. ^ "Rise of the Hackers". www.pbs.org. Retrieved 2019-08-04.
  10. ^ "Defeating the Hackers". Horizon. BBC. 2013-10-01. Retrieved 2014-01-27.
  11. ^ SRI International (2013-10-01). "Cortical Cryptography on BBC Horizon". Twitter. Retrieved 2014-01-27.
  12. ^ Metz, Rachel (2013-06-06). "A Password So Secret, You Don't Consciously Know It". MIT Technology Review. MIT. Retrieved 2013-02-25.
  13. ^ "neurome inc". neurome inc. Retrieved 2019-08-04.
  14. ^ relationalAI. "relationalAI - AI for the enterprise". relationalai. Retrieved 2019-08-04.
  15. ^ "SRI Fellows". SRI International. Retrieved 2013-01-12.
  16. ^ "PRDC 2013". prdc.dependability.org. Retrieved 2019-08-04.
  17. ^ "Google Scholar". scholar.google.com. Retrieved 2019-08-04.

Read other articles:

Морфологічна класифікація мов — типологічна класифікація мов світу на основі принципів морфологічної будови слів. Відповідно до цієї класифікації усі мови поділяються на: кореневі (аморфні, ізолюючі) аглютинативні флективні (фузійні) полісинтетичні (багатоскладові,

 

This article includes a list of references, related reading, or external links, but its sources remain unclear because it lacks inline citations. Please help to improve this article by introducing more precise citations. (March 2015) (Learn how and when to remove this template message) The Gorgon's Gaze First edition hardback coverAuthorJulia GoldingCover artistDavid WyattCountryUnited KingdomLanguageEnglishSeriesCompanions QuartetGenreFantasyPublisherOxford University PressPublication d...

 

Роман Шнейдерман Роман Шнейдерман Особисті дані Повне ім'я Роман Григорович Шнейдерман Народження 24 лютого 1947(1947-02-24)   Українська РСР, СРСР Смерть 3 березня 2010(2010-03-03) (63 роки)   Дніпропетровськ, Україна Громадянство  Україна Позиція півзахисник Професіональні к...

هذه المقالة تحتاج للمزيد من الوصلات للمقالات الأخرى للمساعدة في ترابط مقالات الموسوعة. فضلًا ساعد في تحسين هذه المقالة بإضافة وصلات إلى المقالات المتعلقة بها الموجودة في النص الحالي. (أغسطس 2023) تصف البعثة النيوزيلندية للمسح الجيولوجي في القارة القطبية الجنوبية (NZGSAE)، هي س...

 

Late 8th-century–1215 Iranian dynasty from Ghor, modern Afghanistan Ghurid dynastybefore 786–12151203KHWARAZMIANEMPIREKIPCHAKSABBASIDCALIPHATEZENGIDSYADAVASPARA-MARASCHANDELASQOCHOQARA KHITAIKARA-KHANIDS ◁ ▷ Map of Ghurid territory, before the assassination of Muhammad of Ghor.[1][2][3] In the west, Ghurid territory extended to Nishapur and Merv,[4][5] while Ghurid troops reached as far as Gorgan on the shores of the Caspian Sea.[6][...

 

Pemerintah daerah di Ipoh, Perak, Malaysia. Pemerintah Daerah adalah penyelenggara urusan administrasi pemerintahan oleh pemerintah di daerah dan dewan perwakilan rakyat daerah dengan landasan dasar otonomi dan tugas[1]. Pemerintah daerah merujuk pada otoritas administratif di suatu daerah yang lebih kecil dari sebuah negara. Sebutan ini digunakan untuk melengkapi lembaga-lembaga tingkat negara-bangsa, yang disebut sebagai pemerintah pusat, pemerintah nasional, atau (bila perlu) pemer...

Camarines Norte atau Camarines Utara (Filipino:Hilagang Camarines) merupakan sebuah provinsi di Filipina. Ibu kotanya ialah Daet. Provinsi ini terletak di Region Bicol. Provinsi ini memiliki luas wilayah 2.320,07 km² dengan memiliki jumlah penduduk 513.785 jiwa (2007) dengan memiliki angka kepadatan penduduk 217 jiwa/km². Pembagian wilayah Secara politis provinsi Camarines Norte terbagi menjadi 12 munisipalitas, yaitu: Munisipalitas Jumlah Barangay Luas wilayah(km²) Penduduk(2007) Bas...

 

Russian mystic (1869–1916) Rasputin redirects here. For other uses, see Rasputin (disambiguation). In this name that follows Eastern Slavic naming conventions, the patronymic is Yefimovich and the family name is Rasputin. Grigori RasputinPortrait of Rasputin, c. 1910sNative nameГригорий Ефимович РаспутинChurchRussian Orthodox ChurchPersonal detailsBorn21 January [O.S. 9 January] 1869Pokrovskoye, Tyumensky Uyezd, Tobolsk Governorate, Russia...

 

Santo AmbrosiusUskup Agung MilanMosaik lama yang mungkin saja menampilkan wajah asli Ambrosius.TakhtaMediolanumPenunjukan374 MMasa jabatan berakhir4 April 397PendahuluAuksensiusPenerusSimplisianusImamatTahbisan uskup7 Desember 374Informasi pribadiLahirca. 340Augusta Treverorum,Gallia Belgica, Kekaisaran Romawi(sekarang Trier, Jerman)Meninggal4 April 397 (pada usia 56 atau 57 tahun)Mediolanum,Italia Romawi, Kekaisaran Romawi(sekarang Milan, Italia)Orang kudusPesta7 Desember[1]Ven...

Japanese actress This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Noriko Sengoku – news · newspapers · books · scholar · JSTOR (August 2023) (Learn how and when to remove this template message) Noriko SengokuNoriko Sengoku in 1956.BornReiko Mori(1922-04-29)April 29, 1922Tokyo, JapanDiedDecember 27, 2012(2012-...

 

1996 French filmEncoreFilm posterDirected byPascal BonitzerWritten byPascal BonitzerProduced byClaude KunetzStarringJackie BerroyerValeria Bruni TedeschiCinematographyEmmanuel MachuelEdited bySuzanne KochDistributed byRézo FilmsRelease date 25 September 1996 (1996-09-25) Running time96 minutesCountryFranceLanguageFrenchBudget$1.7 millionBox office$1.9 million[1] Encore is a 1996 French comedy-drama film written and directed by Pascal Bonitzer.[2] The film stars...

 

Daftar ini merupakan daftar alat musik yang berasal dari Indonesia. Alat musik tradisional Alat-alat musik khas Indonesia Genderrang Pakpak Gordang Sambilan Akordeon Angklung Bedug Biola Bonang Calong Calung Fu Gamelan (keluarga): Demung Gong: Gong gedhe Gong kebyar Kendang Saron Gendang Karo Gendang Beleq Genderrang Pakpak Gordang Sambilan Ganda Gendrum Guoto Harmonika Kacapi Karinding Kastanyet Ketipung Kolintang Nafiri Pereret Pengasih-asih Rebab Rebana Rebana Mandar Saluang Sampek Sasando...

Road in Malaysia Selangor Route 52Major junctionsNortheast endLangat DamMajor intersections Jalan SemenyihB62 Jalan Ampang-Hulu Langat Jalan Sungai Tekali FT 1 Federal route 1Southwest endCherasPekan Batu Sembilan (Bt-9) LocationCountryMalaysiaPrimarydestinationsKuala Lumpur, Hulu Langat (Pekan Batu Empat Belas (Bt-14)), Dusun Tua, Sungai Congkak, Sungai Gabai, Semenyih Dam, Semenyih Highway system Highways in Malaysia Expressways Federal State Jalan Hulu Langat (Selangor state rout...

 

Hotel in Honolulu, Hawaii Ala Moana Hotel by MantraAla Moana Hotel (bldg. on the right)Hotel chainMantraGeneral informationLocationHonolulu, HawaiiAddress410 Atkinson Dr.Technical detailsFloor count38Other informationNumber of rooms1,169Number of restaurants3ParkinggarageWebsitehttps://www.alamoanahotelhonolulu.com/ The Ala Moana Hotel is a hotel in Honolulu, Hawaii, opened in 1970. It adjoins the Ala Moana Shopping Center and is across the street from the Hawaii Convention Center as well as ...

 

Online database of US pornographic films and actors Internet Adult Film DatabaseType of sitePornography, movie databaseAvailable inEnglishURLiafd.comCommercialYesLaunched1995; 28 years ago (1995)Current statusOnlineContent licenseProprietary The Internet Adult Film Database (IAFD) is an online database of information pertaining to the pornography industry: actors, actresses, directors, studios, distributors and pornographic films.[1] History The predecessor...

Islam menurut negara Afrika Aljazair Angola Benin Botswana Burkina Faso Burundi Kamerun Tanjung Verde Republik Afrika Tengah Chad Komoro Republik Demokratik Kongo Republik Kongo Djibouti Mesir Guinea Khatulistiwa Eritrea Eswatini Etiopia Gabon Gambia Ghana Guinea Guinea-Bissau Pantai Gading Kenya Lesotho Liberia Libya Madagaskar Malawi Mali Mauritania Mauritius Maroko Mozambik Namibia Niger Nigeria Rwanda Sao Tome dan Principe Senegal Seychelles Sierra Leone Somalia Somaliland Afrika Selatan ...

 

Historic house in Connecticut, United States For the similarly named historic house in Massachusetts, see General John Glover House. United States historic placeJohn Glover HouseU.S. National Register of Historic Places Show map of ConnecticutShow map of the United StatesLocation53 Echo Valley Rd., Newtown, ConnecticutCoordinates41°26′49″N 73°18′34″W / 41.44694°N 73.30944°W / 41.44694; -73.30944Area2 acres (0.81 ha)Built1708Architectural styleColo...

 

2001 film by Bruce Beresford Bride of the WindFilm posterDirected byBruce BeresfordWritten byMarilyn LevyBased onLife of Alma MahlerProduced byMargit BimlerGerald GreenFrank HübnerEvzen KolarLawrence LevyStarringSarah WynterJonathan PryceVincent PerezSimon VerhoevenCinematographyPeter JamesEdited byTimothy WellburnMusic byStephen EndelmanDistributed byParamount ClassicsRelease date 8 June 2001 (2001-06-08) (US) Running time99 minutesCountriesUnited KingdomGermanyAustriaLan...

James W. Jimmy Sturr Jr. James W. Jimmy Sturr Jr., conosciuto come Jimmy Sturr (Warwick, 25 settembre 1941), è un polistrumentista e musicista statunitense. leader del gruppo Jimmy Starr & His Band. Ha vinto 18 Grammy Awards su 24 nomination nella categoria miglior album polka. Vive oggi a Florida un village della Contea di Orange, stato di New York. Discografia Not Just Another Polka Tribute to the Legends of Polka Music Polka Party Polka Cola con Bill Anderson Let the Whole World Sing ...

 

Ancient Egyptian funerary text This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Book of Gates – news · newspapers · books · scholar · JSTOR (September 2021) (Learn how and when to remove this template message)Part of a series onAncient Egyptian religion Beliefs Afterlife Cosmology Duat Ma'at Mythology Numerol...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!