Luís Cabral

Luís Cabral
Luís Cabral at the wedding party of Chico Mendes in Ziguinchor, Senegal (1973)
1st President of Guinea-Bissau
In office
24 September 1973 – 14 November 1980
Prime MinisterFrancisco Mendes
Preceded byOffice created
Succeeded byJoão Bernardo Vieira President of Guinea-Bissau
Personal details
Born
Luís Severino de Almeida Cabral

11 April 1931
Bissau, Portuguese Guinea
Died30 May 2009(2009-05-30) (aged 78)
Torres Vedras, Portugal
Cause of deathCardiac Arrest
Resting placeCemitério do Alto de São João[1]
Political partyAfrican Party for the Independence of Guinea and Cape Verde
SpouseLucete Cabral

Luís Severino de Almeida Cabral (11 April 1931 – 30 May 2009)[2][3][4] was a Bissau-Guinean politician who was the first President of Guinea-Bissau. He served from 1974 to 1980, when a military coup d'état led by João Bernardo Vieira deposed him. Luís Cabral was a half-brother of Amílcar Cabral, with whom he co-founded the African Party for the Independence of Guinea and Cape Verde (PAIGC) in 1956.

Early life

Luís Cabral was born in the city of Bissau, Portuguese Guinea, on April 11, 1931, to mestiço (mixed-race) parents originally from the Cape Verde. He completed his primary school studies in the Cape Verde archipelago, which was also a Portuguese territory at that time. Later he received training in accountancy.[5] He was also educated in Bissau and joined a Portuguese business, Companhia União Fabril.[6]

Pro-independence guerrilla and Presidency

In 1956 Cabral was one of the six founders of the African Party for the Independence of Guinea and Cape Verde (PAIGC). In the early 1960s, PAIGC launched an anti-colonial guerrilla war against the Portuguese authorities. He helped organize a dock strike that was brutally suppressed by the Portuguese authorities. and resulted in a loss of more than 50 lives. This led to the PAIGC abandoning non-violence, which came as a shock to Cabral.[7] Luís Cabral's rise to leadership began in 1973, after the assassination in Conakry, Guinea, of his half-brother Amílcar Cabral, the noted Pan-African intellectual and founder of the PAIGC. Leadership of the party then engaged in fighting for independence from Portuguese rule for both Guinea-Bissau (then known as Portuguese Guinea) and for Cape Verde, fell to Aristides Pereira, who later became the president of Cape Verde. The Guinea-Bissau branch of the party, however, followed Luís Cabral.

Following the Carnation Revolution in April 1974 in Lisbon, the new left-wing revolutionary government of Portugal granted independence to Portuguese Guinea, as Guinea-Bissau, on September 10 that same year. The PAIGC had unilaterally proclaimed the country's independence one year before in the village of Madina do Boé, and this event had been recognized by many socialist and non-aligned member states of the United Nations. Luís Cabral became President of Guinea-Bissau. A program of national reconstruction and development, of socialist inspiration (with the support of USSR, China, but also Nordic countries), began. Access to education and health has improved significantly in a few years.[8] But some suspicion and instability was present in the party since Amílcar Cabral's death and the independence. Relations with Portugal after independence were relatively good. The Guinean president visited Portugal in 1978 and President Ramalho Eanes visited the former colony the next year, referring to the Luso-Guinean relationship as a model for those Portugal sought to establish with Angola and Mozambique.

Some sections of the party accused Luís Cabral and the other members with Cape Verdean origins of dominating the party. Alleging this, Cabral's Prime Minister and former armed forces commander João Bernardo Vieira organized his overthrow on November 14, 1980, in a military coup. Luís Cabral was then arrested and detained for 13 months.

Exile

After the military coup in 1980, he was sent into exile, first in Cuba, which offered to receive him, then (in 1984), in Portugal, where the Portuguese Government received him and gave him measure to live with his family, until his death in 2009.

Shortly after being appointed Prime Minister following the Guinea-Bissau Civil War, Francisco Fadul called for Cabral's return from exile in December 1998. Cabral said in response, in the Portuguese newspaper 24 Horas, that he would be willing to return, but not while Vieira remained in power; Vieira had said that he could not guarantee Cabral's safety, and Cabral said that as a result, he feared for his life should he return while Vieira remained president.[9] On October 22, 1999, following Vieira's ouster, coup leader Ansumane Mane invited Cabral to return, giving him a passport marking him as "President of the Guinea Bissau Council of State" while in Lisbon.[10] Cabral was in Bissau in mid-November 1999, and said on the occasion that he did not want to become active in politics again or to rejoin PAIGC.[11]

Death

Cabral died aged 78 on May 30, 2009, in Torres Vedras, Portugal. His death followed a long bout of illness.

The National Assembly of Guinea-Bissau stated: "It is with shock and sadness that the government and people of Guinea-Bissau have learnt of the loss of one of their most illustrious sons, Luis Cabral".[12][13] It held an emergency session at which it organised a period of national mourning to last three days.[12][14]

Controversies

As the President of Guinea-Bissau, his authoritarian single-party regime[15] was severely repressive and the country was hit by severe food shortages. Luís Cabral was also accused of being responsible for the execution of a large number of black Guinea-Bissauan soldiers who had fought alongside the Portuguese Army against the PAIGC guerrillas during the Portuguese Colonial War, a claim that Cabral always denied.[5][16]

See also

References

  1. ^ "Na Hora do Adeus a Luís Cabral, O Simbolismo da Solidariedade e da Multiculturalidade". Archived from the original on 2021-04-11. Retrieved 2021-02-21.
  2. ^ Guiné Bissau Morreu Luís Cabral, primeiro presidente do país - Expresso.pt Archived 2011-07-21 at the Wayback Machine (in Portuguese)
  3. ^ Morreu Luís Cabral, primeiro presidente do país - RTP Notícias Archived 2011-10-02 at the Wayback Machine (in Portuguese)
  4. ^ Guiné-Bissau: Morreu Luís Cabral, primeiro presidente do país - JN Archived 2009-06-10 at the Wayback Machine (in Portuguese)
  5. ^ a b (in Portuguese) Morreu Luís Cabral, primeiro presidente da Guiné-Bissau independente Archived 2009-06-11 at the Wayback Machine, in Público (May 31, 2009)
  6. ^ "Luís Cabral". The Guardian. 8 June 2009. Archived from the original on 24 August 2017. Retrieved 24 August 2017.
  7. ^ Brockman, Norbert (2006). An African Biographical Dictionary. Grey House Publishing. pp. 102. ISBN 1592371124.
  8. ^ "Tobias Engel, A sina da instabilidade, biblioteca diplo". Retrieved 2022-03-03.
  9. ^ "GUINEA-BISSAU: Former leader ready to return home" Archived 2009-06-10 at the Wayback Machine, IRIN, December 8, 1998.
  10. ^ "Guinea Bissau's first president invited to return from exile", RTP Internacional TV, Lisbon (nl.newsbank.com), October 22, 1999.
  11. ^ "Guinea-Bissau: Former President Cabral returns home 19 years after being ousted", Diario de Noticias web site (nl.newsbank.com), November 15, 1999.
  12. ^ a b "Guinea-Bissau's first leader dies". BBC News. 2009-06-02. Archived from the original on 2009-06-05. Retrieved 2009-06-03.
  13. ^ "Guinea-Bissau's first president dies in Portugal". Xinhua News Agency. 2009-05-31. Archived from the original on 2009-06-10. Retrieved 2009-06-03.
  14. ^ "Guinea Bissau to mourn first president". AfricaNews. 2009-06-02. Archived from the original on 2009-06-03. Retrieved 2009-06-03.
  15. ^ Widening trajectories: Guinea Bissau and Cape Verde since independence, Norrie MacQueen Archived 2015-04-23 at the Wayback Machine
  16. ^ A history of postcolonial Lusophone Africa, A history of postcolonial Lusophone Africa, Patrick Chabal, Edition: C. Hurst & Co. Publishers, 2002, ISBN 1-85065-594-4, ISBN 978-1-85065-594-7
Political offices
New title President of Guinea-Bissau
1974–1980
Succeeded by


Read other articles:

National park in Norway Sassen – Bünsow Land National ParkIUCN category II (national park)LocationSpitsbergen, Svalbard, NorwayNearest cityLongyearbyenCoordinates78°23′N 17°15′E / 78.383°N 17.250°E / 78.383; 17.250Area1,230 km² (1,157 km² land, 73 km² sea)Established2003Governing bodyDirectorate for Nature Management Sassen–Bünsow Land National Park (Norwegian: Sassen–Bünsow Land nasjonalpark) lies on Spitsbergen island in t...

 

Campaign of Ronald Reagan for the election to President of the United States in 1976 For his 1980 and 1984 campaign, see Ronald Reagan 1980 presidential campaign and Ronald Reagan 1984 presidential campaign. Ronald Reagan for President 1976Campaign1976 United States presidential electionCandidateRonald ReaganGovernor of California(1967–1975)AffiliationRepublican PartyStatusAnnounced November 20, 1975[1]Lost nomination August 18, 1976[2]Key peopleJohn Sears (campaign man...

 

Ethnic group in Australia Latvian AustraliansAustrālijas latviešiTotal populationLatvian3,758 (by birth, 2016 census)[1]20,509 (by ancestry, 2016 census)[1]Regions with significant populationsSydney and MelbourneLanguagesAustralian English, LatvianReligionLutheran, Roman Catholic, OrthodoxRelated ethnic groupsLithuanian Australians · Latgalians · Kursenieki · Livonians · Latvians  · Latvian Canadians ...

ميات غاسينوفيتش   معلومات شخصية الميلاد 8 فبراير 1995 (28 سنة)[1][2]  نوفي ساد  الطول 1.75 م (5 قدم 9 بوصة) مركز اللعب وسط الجنسية ألبانيا البوسنة والهرسك  معلومات النادي النادي الحالي أيك أثينا الرقم 8 مسيرة الشباب سنوات فريق FK Leotar [الإنجليزية]‏ فويفودين

 

Krzyż Matyldy wykonany ku czci Matyldy II, opatki klasztoru w Essen w latach 973–1011. Na emaliowanej plakietce ukazana jest Matylda klęcząca przed Maryją z Dzieciątkiem Jezus. Wykonany na zlecenie opatki Teofano ok. 1050, jest przykładem crux gemmata. Zastosowano przy jego wykonaniu kilka technik znanych już w średniowieczu takich jak figuratywizm, odlewnictwo, filigran, emaliowanie, obróbkę kamieni szlachetnych i ich osadzanie w metalu, a także użycie kamei i gemm. Fortyfikacj...

 

Mata KetigaAlbum studio karya Rieka RoslanDirilis5 Mei 2005Genrejazz, fusion, soulLabel(independen)Kronologi Rieka Roslan -String Module Error: Match not foundString Module Error: Match not found Mata Ketiga (2005) Bercerita (2006)String Module Error: Match not foundString Module Error: Match not found Mata Ketiga merupakan sebuah album musik solo perdana karya penyanyi Indonesia sekaligus vokalis utama The Groove, Rieka Roslan. Album ini dirilis pada tahun 2005, dengan lagu “Matahari...

Petar II Petrović-Njegoš (Abjad Kiril Serbia: Петар II Петровић-Његош, pelafalan Serbo-Kroasia: [pětar drûɡi pětroʋitɕ ɲêɡoʃ]; 13 November 1813 – 31 Oktober 1851), adalah Pangeran-Uskup (vladika), penyair dan filsuf Montenegro yang karya-karyanya dianggap sebagai salah satu yang terpenting dalam sastra Serbia dan Montenegro. Njegoš lahir di desa Njeguši, dekat ibu kota Montenegro, Cetinje. Ia dididik di berbagai biara di Montenegro dan ...

 

Late 8th-century–1215 Iranian dynasty from Ghor, modern Afghanistan Ghurid dynastybefore 786–12151203KHWARAZMIANEMPIREKIPCHAKSABBASIDCALIPHATEZENGIDSYADAVASPARA-MARASCHANDELASQOCHOQARA KHITAIKARA-KHANIDS ◁ ▷ Map of Ghurid territory, before the assassination of Muhammad of Ghor.[1][2][3] In the west, Ghurid territory extended to Nishapur and Merv,[4][5] while Ghurid troops reached as far as Gorgan on the shores of the Caspian Sea.[6][...

 

Lista światowego dziedzictwa UNESCO w Irlandii – lista miejsc w Irlandii wpisanych na listę światowego dziedzictwa UNESCO, ustanowionej na mocy Konwencji w sprawie ochrony światowego dziedzictwa kulturowego i naturalnego, przyjętej przez UNESCO na 17. sesji w Paryżu 16 listopada 1972[1] i ratyfikowanej przez Irlandię 16 września 1991 roku[2]. Obecnie (stan w 2018 roku) na liście znajdują się dwa wpisy o charakterze dziedzictwa kulturowym[2]. Na irlandzkiej liście informacyjnej U...

Antibody with the ability to neutralize a specific toxin For bacterially-produced antitoxins, see toxin-antitoxin system. A vintage 1895 vial of diphtheria antitoxin. An antitoxin is an antibody with the ability to neutralize a specific toxin. Antitoxins are produced by certain animals, plants, and bacteria in response to toxin exposure. Although they are most effective in neutralizing toxins, they can also kill bacteria and other microorganisms. Antitoxins are made within organisms, and can ...

 

Broad southernmost part of the African continental shelf Agulhas BankMap of the Agulhas Bank centred on the Outeniqua BasinEcologyRealmTemperate Southern AfricaGeographyArea116,000 km2 (45,000 sq mi)CountrySouth AfricaElevation-50 to -200 mCoordinates34°42′33.1″S 22°28′12.4″E / 34.709194°S 22.470111°E / -34.709194; 22.470111Oceans or seasAtlantic Ocean, Indian Ocean The Agulhas Bank (/əˈɡʌləs/, from Portuguese for Cape Agulhas, Cabo das ...

 

Site of a former Iron Age plateau fort in the County of Hampshire 3D view of the digital terrain model Bullsdown Camp is the site of a former Iron Age plateau fort in the County of Hampshire. The site is heavily wooded, and close inspection is required to observe the three bank and ditch fortifications. Although eroded heavily the earthworks are still impressive[1] Location The site lies to between the villages of Bramley Green and Sherfield on Loddon, in Hampshire. The River Loddon l...

Cet article est une ébauche concernant une unité ou formation militaire allemande. Vous pouvez partager vos connaissances en l’améliorant (comment ?) selon les recommandations des projets correspondants. 1. Flak-Division Flak lourde sur le Berliner Zoo-Bunker Création 1er septembre 1941 Dissolution 8 mai 1945 Pays Allemagne Allégeance Wehrmacht Branche Luftwaffe Type Division de la Luftwaffe Rôle Flak Guerres Seconde Guerre mondiale modifier  La 1. Flak-Division[1] (1re ...

 

2022 Indian Hindi-language film by Vikas Bhal GoodbyeTheatrical release posterDirected byVikas BahlWritten byVikas BahlProduced byShobha KapoorEkta KapoorViraj SavantVikas BahlStarringAmitabh BachchanRashmika MandannaNeena GuptaElli AvrRam Abhishekh KhanCinematographySudhakar Reddy YakkantiEdited byA. Sreekar PrasadMusic byAmit TrivediProductioncompaniesGood Co.Balaji Motion PicturesSaraswati Entertainment Pvt LtdDistributed byZee StudiosRelease date 7 October 2022 (2022-10-07)...

 

Artikel ini memberikan informasi dasar tentang topik kesehatan. Informasi dalam artikel ini hanya boleh digunakan hanya untuk penjelasan ilmiah, bukan untuk diagnosis diri dan tidak dapat menggantikan diagnosis medis. Perhatian: Informasi dalam artikel ini bukanlah resep atau nasihat medis. Wikipedia tidak memberikan konsultasi medis. Jika Anda perlu bantuan atau hendak berobat, berkonsultasilah dengan tenaga kesehatan profesional. Aneurisma adalah pelebaran abnormal pada pembuluh nadi karena...

San Paolo Bel SitoKomuneComune di San Paolo Bel SitoLokasi San Paolo Bel Sito di Provinsi NapoliNegara ItaliaWilayah CampaniaProvinsiNapoli (NA)Luas[1] • Total2,95 km2 (1,14 sq mi)Ketinggian[2]50 m (160 ft)Populasi (2016)[3] • Total3.422 • Kepadatan1,200/km2 (3,000/sq mi)Zona waktuUTC+1 (CET) • Musim panas (DST)UTC+2 (CEST)Kode pos80030Kode area telepon081Situs webhttp://www.comune....

 

Disused railway station in South Yorkshire, England Wombwell CentralSite of the former station (2007)General informationLocationWombwell, BarnsleyEnglandCoordinates53°31′22″N 1°23′36″W / 53.5229°N 1.3932°W / 53.5229; -1.3932Grid referenceSE403030Platforms2Other informationStatusDisusedHistoryOriginal companySouth Yorkshire RailwayPre-groupingGreat Central RailwayPost-groupingLondon and North Eastern RailwayKey dates1851opened29 June 1959closed for passenger...

 

This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Sentul Timur LRT station – news · newspapers · books · scholar · JSTOR (July 2010) (Learn how and when to remove this template message)  AG1   SP1  Sentul Timur | LRT stationPlatform view of the station.General informationOther names冼都...

Laura Voutilainen Sanna Laura Voutilainen (ibland bara Laura) är artist, född 17 maj 1975 i Jyväskylä, Finland. Lauras genombrott kom med låten Kerran 1993 och året efter kom hennes första album. Det sålde i över 120 000 exemplar. Hon har vunnit flera inhemska musikpris och vann även Euroviisut, den finska uttagningen till Eurovision Song Contest 2002. Hon representerade Finland i Tallinn med låten Addicted to You och trots att hon förutspåddes få en bra placering slutade hon kv...

 

Artikel ini sebatang kara, artinya tidak ada artikel lain yang memiliki pranala balik ke halaman ini.Bantulah menambah pranala ke artikel ini dari artikel yang berhubungan atau coba peralatan pencari pranala.Tag ini diberikan pada November 2022. Ana SuheriS.H., M.H. Rektor Universitas PGRI Palangka Raya ke-4PetahanaMulai menjabat 11 Mei 2019 PendahuluMaharidiawan PutraPenggantiPetahana Informasi pribadiLahir15 November 1970 (umur 53)Palangka RayaKebangsaanIndonesiaAlma materUnive...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!