Antanas Zapolskis

Antanas Zapolskis
CountryLithuania
Born (1962-04-20) 20 April 1962 (age 62)
Vilnius, Lithuania
TitleInternational Master (IM, 1992)
Peak rating2420 (July 1992)

Antanas Zapolskis (born 20 April 1962) is a Lithuanian chess player who holds the titles of International Master (IM, 1992). He is two times winner of Lithuanian Chess Championship (1995, 1999).

Biography

Antanas Zapolskis was a multiple participant of the Lithuanian Chess Championships, in which he won two gold medals (1995, 1999).[1][2][3]

In 1995 in Riga he participated in World Chess Championship Baltic Zonal tournament.[4]

In 1997 Antanas Zapolskis was winner of the Open Chess Tournament Heart of Finland (shared 1st-3rd places with Mikhail Rychagov and Aleksander Veingold).[5] In 2005 he won International Chess Tournament Arcimpex Cup in Frýdek-Místek.[6]

Antanas Zapolskis played for Lithuania in the European Team Chess Championships:[7]

  • In 1999, at second board in the 12th European Team Chess Championship in Batumi (+4, =1, -4),
  • In 2003, at fourth board in the 14th European Team Chess Championship in Plovdiv (+1, =1, -6).

Antanas Zapolskis also two times played for Lithuanian chess clubs in European Chess Club Cups (1996, 2008).[8]

In 1992 he was awarded the FIDE International Master (IM) title.

References

  1. ^ Bertašius A. Lietuvos sporto žinynas. Vilnius: Lietuvos sporto informacijos centras, 2005. T. 13. P. 233—234.
  2. ^ Bertašius A. Lietuvos sporto žinynas. Vilnius: Lietuvos sporto informacijos centras, 2005. T. 14. P.278.
  3. ^ R. Survila. Lietuvos čempiono titulas — antrą kartą A. Zapolskiui// Respublika, 1999 kov. 31, Nr. 73. P. 19.
  4. ^ Riga zt 1995 - 365Chess.com Tournaments
  5. ^ Heart of Finland op 1997 - 365Chess.com Tournaments
  6. ^ Frydek Mistek Arcimpex Cup 2005 - 365Chess.com Tournaments
  7. ^ "OlimpBase :: European Men's Team Chess Championship :: Antanas Zapolskis". www.olimpbase.org.
  8. ^ OlimpBase :: European Men's Chess Club Cup :: Antanas Zapolskis


Read other articles:

Men's pullover robe worn in Senegal Two Senegalese kaftans being worn in Cameroon, right. A Senegalese kaftan is a pullover men's robe with long bell sleeves. In the Wolof language, this robe is called a mbubb or xaftaan and in French it is called a boubou. The Senegalese caftan is an ankle length garment. It is worn with matching drawstring pants called tubay in Wolof. Normally made of cotton brocade, lace, or synthetic fabrics, these robes are common throughout West Africa. A kaftan and mat...

 

Guerra in Somaliaparte guerra civile somalaData20 dicembre 2006 – in corso LuogoSud Somalia EsitoVittoria dell'Alleanza per la Riliberazione della Somalia Schieramenti UCI ARS Al-Shabaab Ras Kamboni Brigades Jabhatul Islamiya Muaskar Anole Al-Qaeda Eritrea Etiopia Governo federale di transizione Puntland Galmudug Signori della guerra Stati Uniti Regno UnitoAMISOM Kenya Uganda Burundi Comandanti Sharif Ahmed Hassan Aweys[1] Yusuf Indacade Fuad Moham...

 

U.S. state This article is about the U.S. state. For other uses, see Idaho (disambiguation). State in the United StatesIdahoStateState of Idaho FlagSealNickname(s): The Gem State (official), The Potato StateMotto: Esto perpetua (Latin for Let it be perpetual)[1]Anthem: Here We Have IdahoMap of the United States with Idaho highlightedCountryUnited StatesBefore statehoodOregon Territory, Washington Territory, Idaho TerritoryAdmitted to the UnionJuly 3, 1890 (43rd)Capital(and l...

Municipality in Rio Grande do Sul, BrazilPortãoMunicipality FlagCoat of armsLocation within Rio Grande do SulPortãoLocation in BrazilCoordinates: 29°41′34″S 51°14′06″W / 29.69278°S 51.23500°W / -29.69278; -51.23500Country BrazilStateRio Grande do SulPopulation (2020 [1]) • Total37,561Time zoneUTC−3 (BRT) Portão is a municipality in the state of Rio Grande do Sul, Brazil. See also List of municipalities in Rio Grande do...

 

ميرل ليلاند يونغز معلومات شخصية تاريخ الميلاد 2 ديسمبر 1886  تاريخ الوفاة 8 أكتوبر 1958 (71 سنة)   الحياة العملية المهنة شخصية أعمال ضخمة  [لغات أخرى]‏  تعديل مصدري - تعديل   هذه المقالة يتيمة إذ تصل إليها مقالات أخرى قليلة جدًا. فضلًا، ساعد بإضافة وصلة إليها في مقال

 

State Legislative Assembly Constituency in Tamil Nadu For the mosque, see Thousand Lights Mosque. Thousand LightsConstituency No. 20 for the Tamil Nadu Legislative AssemblyConstituency detailsCountryIndiaRegionSouth IndiaStateTamil NaduDistrictChennaiLS constituencyChennai CentralTotal electors240,073[1]ReservationNoneMember of Legislative Assembly16th Tamil Nadu Legislative AssemblyIncumbent Ezhilan Naganathan Party  DMKAlliance  SPAElected year2021 Thousand Light...

Artikel ini memiliki beberapa masalah. Tolong bantu memperbaikinya atau diskusikan masalah-masalah ini di halaman pembicaraannya. (Pelajari bagaimana dan kapan saat yang tepat untuk menghapus templat pesan ini) Kontributor utama artikel ini tampaknya memiliki hubungan dekat dengan subjek. Artikel ini mungkin memerlukan perapian untuk mematuhi kebijakan konten Wikipedia, terutama dalam hal sudut pandang netral. Silakan dibahas lebih lanjut di halaman pembicaraan artikel ini. Artikel ini berisi...

 

1993 single by Chanté MooreIt's AlrightSingle by Chanté Moorefrom the album Precious ReleasedJanuary 23, 1993 (1993-01-23)Length4:24Label Silas MCA Songwriter(s) Chanté Moore Vassal Benford Producer(s) Vassal Benford Chanté Moore singles chronology Love's Taken Over (1992) It's Alright (1993) Who Do I Turn To? (1993) It's Alright is a song by American singer Chanté Moore. It was written by Moore and Vassal Benford for her debut studio album, Precious (1992), with productio...

 

موسيقى تونسيةمعلومات عامةالبلد تونس أصول الأسلوب موسيقى شمال إفريقيا تعديل - تعديل مصدري - تعديل ويكي بيانات فرقة فولكلورية من جزيرة قرقنة فرقة ميراث أثناء حفلة في مدريد.تتميز الموسيقى التونسية بتنوع كبير على مستوى أصنافها وألوانها. تنقسم الموسيقى التونسية أساسا إلى ثلاث...

18th episode of the 1st season of Agents of S.H.I.E.L.D. ProvidenceAgents of S.H.I.E.L.D. episodeThe Art of Level Seven poster for the episodeEpisode no.Season 1Episode 18Directed byMilan CheylovWritten byBrent FletcherProduced by Jed Whedon Maurissa Tancharoen Jeffrey Bell Cinematography byFeliks Parnell[citation needed]Editing byConrad Smart[citation needed]Original air dateApril 15, 2014 (2014-04-15)Running time42 minutesGuest appearances Bill Paxton as ...

 

Legality, use and culture of cannabis in the U.S. state of Montana Part of a series onCannabis ArtsCulture 420 Books Magu (deity) Names Religion Judaism Latter-day Saints Sikhism Smoke-in Spiritual use Sports Stoner film Stoner rock Terms Chemistry Cannabinoid receptors Cannabinoid receptor type 1 Cannabinoid receptor type 2 Cannabinoids 2-AG 2-AGE, Noladin ether AEA CBC CBL CBD CBDV CBG CBN CBV NADA THC THCV Virodhamine Synthetic cannabinoids AM-2201 CP-55940 Dimethylheptylpyran HU-210 HU-33...

 

Belgian footballer (born 1999) In this Congolese name, the surname is Sambi and the post-surname is Lokonga. Albert Sambi Lokonga Sambi Lokonga with Arsenal in 2022Personal informationFull name Albert-Mboyo Sambi Lokonga[1]Date of birth (1999-10-22) 22 October 1999 (age 24)Place of birth Verviers, Liège, BelgiumHeight 1.83 m (6 ft 0 in)Position(s) Central midfielderTeam informationCurrent team Luton Town(on loan from Arsenal)Number 28Youth career2010–2017 An...

Historical dynasty based in Ghazni and Gardez Lawik dynastyc.750 CE–977 CE Ghazni was the power-center of the Lawik dynasty. Citadel of Ghazni pictured above LAWIKDYNASTYSAFFARIDSSAMANIDSABBASIDCALIPHATEBYZANTINEEMPIREGUJARA-PRATIHARAPALA EMPIREUTPALADYNASTYHINDUSHAHISclass=notpageimage| Approximate location of the Lawik dynastyHindu ShahisLAWIKSSamarkandHeratSAFFARIDS/SAMANIDS/GhaznavidsBalkhKandaharGhazniGardezKabulHundUTPALADYNASTYKHUDAHSBukharaAFSHINSBostclass=notpageimage| The Lawik Dy...

 

Часовий ряд: випадкові точки даних плюс тенденція, з найкраще допасованою лінією та різними застосованими фільтрами Часовий ряд (англ. time series) — це ряд точок даних[en], проіндексованих (або перелічених, або відкладених на графіку) в хронологічному порядку. Найчастіше ча...

 

British children's graphic novel series HildaFranchise logo used since 2018Created byLuke PearsonOriginal workHildafolk (2010)OwnerBooks: Nobrow Press TV series: Sony Pictures Entertainment/NetflixPrint publicationsBook(s) see below Films and televisionFilm(s) Hilda and the Mountain King (2021) Animated series Hilda (2018–2023)GamesTraditional Hilda Creatures (2018) AudioSoundtrack(s) Hilda and the Mountain King (Original Motion Picture Soundtrack) Hilda: Season 1 (Original Series Soundtrac...

Railway station in Kuala Lumpur, Malaysia For Kuala Lumpur's main railway station, see Kuala Lumpur Sentral railway station. This article needs additional citations for verification. Please help improve this article by adding citations to reliable sources. Unsourced material may be challenged and removed.Find sources: Kuala Lumpur railway station – news · newspapers · books · scholar · JSTOR (August 2012) (Learn how and when to remove this template mes...

 

Genus of birds Skylark redirects here. For other uses, see Skylark (disambiguation). For the asteroid (702) Alauda, see 702 Alauda. For the Roman Legion, see Legio V Alaudae. Alauda Eurasian skylark (Alauda arvensis) Song of Eurasian skylark Scientific classification Domain: Eukaryota Kingdom: Animalia Phylum: Chordata Class: Aves Order: Passeriformes Family: Alaudidae Genus: AlaudaLinnaeus, 1758 Type species Alauda arvensisLinnaeus, 1758 Species see text Alauda is a genus of larks found acro...

 

Series of demonstrations in Chicago in 1965–1966 Chicago Freedom MovementPart of the Civil Rights MovementDate1965–1966 (2 years)LocationChicago, IllinoisCaused by De facto racial segregation in education, housing, and employment SCLC's establishment of a campaign in the Northern United States Resulted in Freedom Sunday rally and Chicago City Hall march led by Martin Luther King Jr. in 1966 Chicago branch of Operation Breadbasket established in 1966 Summit Agreement produced on August 26,...

Town in Nova Scotia, CanadaKentvilleTownThe iconic Cornwallis Inn, now Main Street Station, in Downtown Kentville. SealMotto: Magna E ParvaKentvilleLocation of Kentville, Nova ScotiaShow map of Nova ScotiaKentvilleKentville (Canada)Show map of CanadaCoordinates: 45°04′39″N 64°29′45″W / 45.07750°N 64.49583°W / 45.07750; -64.49583CountryCanadaProvinceNova ScotiaCountyKings CountyIncorporated7 December 1886Electoral Districts    ...

 

1993 studio album by Aaron TippinCall of the WildStudio album by Aaron TippinReleasedAugust 10, 1993Recorded1993 at SoundShop Recording Studios, Nashville, TNGenreCountryLength32:45LabelRCA NashvilleProducerScott HendricksAaron Tippin chronology Read Between the Lines(1992) Call of the Wild(1993) Lookin' Back at Myself(1994) Singles from Call of the Wild Workin' Man's Ph.D.Released: June 21, 1993 The Call of the WildReleased: October 23, 1993 Honky Tonk SupermanReleased: January 1994 ...

 

Strategi Solo vs Squad di Free Fire: Cara Menang Mudah!